DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and RGD1308751

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:XP_225137.5 Gene:RGD1308751 / 290981 RGDID:1308751 Length:330 Species:Rattus norvegicus


Alignment Length:325 Identity:117/325 - (36%)
Similarity:180/325 - (55%) Gaps:33/325 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 HSHRFDKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNANEMGSAKYG----ITEF 357
            |...||.|   :.:::.:.|:.|.:..|.|.| .::..|:|.| .|:..:....|:|    :..|
  Rat    21 HDPSFDTV---WEEWKTKHGKTYNTNEEGQKR-AVWENNMKMI-NLHNEDYLKGKHGFSLEMNAF 80

  Fly   358 ADMTSSEYKE-RTGLWQRDEAKATGGSAAVV--PAYHGELPKEFDWRQKDAVTQVKNQGSCGSCW 419
            .|:|::|::| .||.      ::.|.....:  ..:.|::||..|||:...||.|||||.|||||
  Rat    81 GDLTNTEFRELMTGF------QSMGPKETTIFREPFLGDIPKSLDWREHGYVTPVKNQGQCGSCW 139

  Fly   420 AFSVTGNIEGLYAVKTGELKEFSEQELLDCDTT--DSACNGGLMDNAYKAIKDIGGLEYEAEYPY 482
            |||..|::||....|||:|...|||.|:||..:  :..||||||:.|::.:|:..||:....|.|
  Rat   140 AFSAVGSLEGQIFKKTGKLVSLSEQNLVDCSWSYGNLGCNGGLMEFAFQYVKENRGLDTGESYAY 204

  Fly   483 KAKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINAN--AMQFYRGGVSHPWK 545
            :|:...|.:|...|...|.|||.:|...:..|.. :.:.||:|:||:::  :.:||.||:.  ::
  Rat   205 EAQDGLCRYNPKYSAANVTGFVKVPLSEDDLMSA-VASVGPVSVGIDSHHQSFRFYSGGMY--YE 266

  Fly   546 ALCSKKNLDHGVLVVGYG-VSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRG-DNTCGVSEMA 608
            ..||...:||.||||||| .||...      ||:||||||..||..||.::.:. :|.||::..|
  Rat   267 PDCSSTEMDHAVLVVGYGEESDGGK------YWLVKNSWGEDWGMDGYIKMAKDQNNNCGIATYA 325

  Fly   609  608
              Rat   326  325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 14/60 (23%)
Peptidase_C1A 395..611 CDD:239068 93/220 (42%)
RGD1308751XP_225137.5 Inhibitor_I29 29..87 CDD:214853 14/59 (24%)
Peptidase_C1 114..329 CDD:278538 93/221 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100116
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.