DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and Ctsr

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_783171.2 Gene:Ctsr / 290975 RGDID:631422 Length:334 Species:Rattus norvegicus


Alignment Length:343 Identity:115/343 - (33%)
Similarity:171/343 - (49%) Gaps:62/343 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 EWAEKKTHKKHSHRFDKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNANEMGSAK 351
            ||.:.||..:.|:..::..|                     |..::.:|:|.| :|:..|....|
  Rat    28 EWHDWKTEYEKSYTMEEEGH---------------------RRAVWEENMKMI-KLHNRENSLGK 70

  Fly   352 YG----ITEFADMTSSEYKE----------RTG--LWQRDEAKATGGSAAVVPAYHGELPKEFDW 400
            .|    :.||.|:|:.|:::          |.|  :.:||....              |||..||
  Rat    71 NGFIMEMNEFGDLTAEEFRKMMVNIPIRSHRKGKIIRKRDVGNV--------------LPKFVDW 121

  Fly   401 RQKDAVTQVKNQGSCGSCWAFSVTGNIEGLYAVKTGELKEFSEQELLDCDTT--DSACNGGLMDN 463
            |:|..||:|:||..|.|||||:|||.|||....|||:|...|.|.|:||..:  :..|..|....
  Rat   122 RKKGYVTRVQNQKFCNSCWAFAVTGAIEGQMFNKTGQLTPLSVQNLVDCTKSQGNEGCQWGDPHI 186

  Fly   464 AYKAIKDIGGLEYEAEYPYKAKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGI 528
            ||:.:.:.||||.||.||||.|:..|.:|...|..::.|||.||: :|..:.|.:...||||:.:
  Rat   187 AYEYVLNNGGLEAEATYPYKGKEGVCRYNPKHSKAEITGFVSLPE-SEDILMEAVATIGPISVAV 250

  Fly   529 NA--NAMQFYRGGVSHPWKALCSKKNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQG 591
            :|  |:..||:.|:..  :..||...::|.|||||||...  |......||::|||||.:||.:|
  Rat   251 DASFNSFGFYKKGLYD--EPNCSNNTVNHSVLVVGYGFEG--NETDGNSYWLIKNSWGRKWGLRG 311

  Fly   592 YYRVYRGDNT-CGVSEMA 608
            |.::.:..|. |.::..|
  Rat   312 YMKIPKDQNNFCAIASYA 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 12/60 (20%)
Peptidase_C1A 395..611 CDD:239068 91/219 (42%)
CtsrNP_783171.2 PTZ00203 7..332 CDD:185513 115/343 (34%)
Inhibitor_I29 29..87 CDD:214853 17/79 (22%)
Peptidase_C1A 116..332 CDD:239068 91/219 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.