DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and Testin

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_775155.1 Gene:Testin / 286916 RGDID:708447 Length:333 Species:Rattus norvegicus


Alignment Length:344 Identity:124/344 - (36%)
Similarity:178/344 - (51%) Gaps:53/344 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 VEWAEKKTHKKHSHRFDKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNANEMGSA 350
            |||.|.:|  ||                  |:.|....|| ::..::.:|.|.| ||:..|....
  Rat    27 VEWNEWRT--KH------------------GKTYNMNEER-LKRAVWEKNFKMI-ELHNWEYLEG 69

  Fly   351 KYGIT----EFADMTSSEY-KERTGLWQRDEAKATGGSAAVVPAYHGEL--PKEFDWRQKDAVTQ 408
            ::..|    .|.|:|:.|: |..|| :||.:.|.|.     :...|..|  ||..||||...||.
  Rat    70 RHDFTMAMNAFGDLTNIEFVKMMTG-FQRQKIKKTH-----IFQDHQFLYVPKRVDWRQLGYVTP 128

  Fly   409 VKNQGSCGSCWAFSVTGNIEGLYAVKTGELKEFSEQELLDC--DTTDSACNGGLMDNAYKAIKDI 471
            |||||.|.|.||||.||::||....||..|...|||.||||  ......|:||.|..|::.:||.
  Rat   129 VKNQGHCASSWAFSATGSLEGQMFRKTERLIPLSEQNLLDCMGSNVTHGCSGGFMQYAFQYVKDN 193

  Fly   472 GGLEYEAEYPYKAKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINAN--AMQ 534
            |||..|..|||:.:..:|.::...|...|..||.:| |:|.|:.:.:...||||:.::|:  :.|
  Rat   194 GGLATEESYPYRGQGRECRYHAENSAANVRDFVQIP-GSEEALMKAVAKVGPISVAVDASHGSFQ 257

  Fly   535 FYRGGVSHPWKALCSKKNLDHGVLVVGYGV----SDYPNFHKTLPYWIVKNSWGPRWGEQGYYRV 595
            ||..|:.  ::..|.:.:|:|.|||||||.    ||..:|      |:||||||..||.:||.::
  Rat   258 FYGSGIY--YEPQCKRVHLNHAVLVVGYGFEGEESDGNSF------WLVKNSWGEEWGMKGYMKL 314

  Fly   596 YRG-DNTCGVSEMATSAVL 613
            .:. .|.||::..:|..::
  Rat   315 AKDWSNHCGIATYSTYPIV 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 14/60 (23%)
Peptidase_C1A 395..611 CDD:239068 93/224 (42%)
TestinNP_775155.1 Inhibitor_I29 29..87 CDD:214853 19/79 (24%)
Peptidase_C1 114..332 CDD:395062 93/226 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.