DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and TINAG

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_055279.3 Gene:TINAG / 27283 HGNCID:14599 Length:476 Species:Homo sapiens


Alignment Length:330 Identity:78/330 - (23%)
Similarity:128/330 - (38%) Gaps:81/330 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   339 IEELNANEMGSAKYGITEFADMTSSE-YKERTG-------LWQRDEAKATGGSAAVVPAY----- 390
            ||::|..:.|......::|..||..: :|.|.|       |...:|..|:..:...:|.:     
Human   161 IEQVNKGDYGWTAQNYSQFWGMTLEDGFKFRLGTLPPSPMLLSMNEMTASLPATTDLPEFFVASY 225

  Fly   391 ------HGELPKEFDWRQKDAVTQVKNQGSCGSCWAFSVTGNIEGLYAVK-----TGELKEFSEQ 444
                  ||.|                :|.:|.:.||||.........|::     |..|   |.|
Human   226 KWPGWTHGPL----------------DQKNCAASWAFSTASVAADRIAIQSKGRYTANL---SPQ 271

  Fly   445 ELLDCDTTD-SACNGGLMDNAYKAIKDIGGLEYEAEYP----YKAKKNQC------------HFN 492
            .|:.|...: ..||.|.:|.|:..::. .||...|.||    ..|..|.|            |..
Human   272 NLISCCAKNRHGCNSGSIDRAWWYLRK-RGLVSHACYPLFKDQNATNNGCAMASRSDGRGKRHAT 335

  Fly   493 RTL-SHVQVAGFV---DLP---KGNETAMQEWLLANGPISIGINANAMQF-YRGGVSHPWKALCS 549
            :.. ::|:.:..:   ..|   ..|||.:.:.::.|||:...:......| |:.|:   ::.:.|
Human   336 KPCPNNVEKSNRIYQCSPPYRVSSNETEIMKEIMQNGPVQAIMQVREDFFHYKTGI---YRHVTS 397

  Fly   550 --------KKNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRGDNTCGVSE 606
                    :|...|.|.:.|:|........|. .:||..||||..|||.||:|:.||.|...:.:
Human   398 TNKESEKYRKLQTHAVKLTGWGTLRGAQGQKE-KFWIAANSWGKSWGENGYFRILRGVNESDIEK 461

  Fly   607 MATSA 611
            :..:|
Human   462 LIIAA 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 7/26 (27%)
Peptidase_C1A 395..611 CDD:239068 60/253 (24%)
TINAGNP_055279.3 Somatomedin_B 61..104 CDD:279385
VWC 120..>154 CDD:302663
Peptidase_C1A_CathepsinB 218..466 CDD:239111 64/271 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.