DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and Tinag

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_036163.3 Gene:Tinag / 26944 MGIID:1349477 Length:475 Species:Mus musculus


Alignment Length:340 Identity:81/340 - (23%)
Similarity:123/340 - (36%) Gaps:101/340 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   339 IEELNANEMGSAKYGITEFADMTSSE-YKERTG-------LWQRDEAKATGGSAAVVP-----AY 390
            |:.:|..:.|......::|..||..| :|.|.|       |...:|..|:....|.:|     :|
Mouse   160 IDHINKGDYGWTAQNYSQFWGMTLEEGFKFRLGTLPPSPMLLSMNEMTASFPPRADLPEIFIASY 224

  Fly   391 ------HGELPKEFDWRQKDAVTQVKNQGSCGSCWAFSVTGNIEGLYAVK-----TGELKEFSEQ 444
                  ||.|                :|.:|.:.||||.........|::     |..|   |.|
Mouse   225 KWPGWTHGPL----------------DQKNCAASWAFSTASVAADRIAIQSKGRYTANL---SPQ 270

  Fly   445 ELLDCDTTD-SACNGGLMDNAYKAIKDIGGLEYEAEYPYKAKKNQCH------------------ 490
            .|:.|...: ..||.|.:|.|:..::. .||...|.||....:|..:                  
Mouse   271 NLISCCAKNRHGCNSGSIDRAWWFLRK-RGLVSHACYPLFKDQNTTNNICAMASRSDGRGKRHAT 334

  Fly   491 ------FNRTLSHVQVAGFVDLP----KGNETAMQEWLLANGPISIGINANAMQ------FYRGG 539
                  |.::....|.:     |    ..|||.:...::.|||:..     .||      :|:.|
Mouse   335 KPCPNSFEKSNRIYQCS-----PPYRVSSNETEIMREIIQNGPVQA-----IMQVHEDFFYYKTG 389

  Fly   540 V--------SHPWKALCSKKNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVY 596
            :        ..|.|   .||...|.|.:.|:|........|. .:||..||||..|||.||:|:.
Mouse   390 IYRHVVSTNEEPEK---YKKLRTHAVKLTGWGTLRGARGKKE-KFWIAANSWGKSWGENGYFRIL 450

  Fly   597 RGDNTCGVSEMATSA 611
            ||.|...:.::..:|
Mouse   451 RGVNESDIEKLIIAA 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 7/26 (27%)
Peptidase_C1A 395..611 CDD:239068 61/263 (23%)
TinagNP_036163.3 Somatomedin_B 60..103 CDD:279385
VWC 119..>166 CDD:302663 2/5 (40%)
Peptidase_C1A_CathepsinB 217..465 CDD:239111 66/281 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.