DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and Ctsl

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_037288.1 Gene:Ctsl / 25697 RGDID:2448 Length:334 Species:Rattus norvegicus


Alignment Length:342 Identity:128/342 - (37%)
Similarity:189/342 - (55%) Gaps:43/342 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 TRSVEWAE-KKTHKKHSHRFDKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNANE 346
            |.:.:|.: |.||                      ||...|.|.:.|..::.:|::.| :|:..|
  Rat    24 TFNAQWHQWKSTH----------------------RRLYGTNEEEWRRAVWEKNMRMI-QLHNGE 65

  Fly   347 MGSAKYGIT----EFADMTSSEYKERTGLWQRDEAKATGGSAAVVPAYHGELPKEFDWRQKDAVT 407
            ..:.|:|.|    .|.|||:.|:::....::..:.|.  |.....|... ::||..|||:|..||
  Rat    66 YSNGKHGFTMEMNAFGDMTNEEFRQIVNGYRHQKHKK--GRLFQEPLML-QIPKTVDWREKGCVT 127

  Fly   408 QVKNQGSCGSCWAFSVTGNIEGLYAVKTGELKEFSEQELLDC--DTTDSACNGGLMDNAYKAIKD 470
            .|||||.||||||||.:|.:||...:|||:|...|||.|:||  |..:..|||||||.|::.||:
  Rat   128 PVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHDQGNQGCNGGLMDFAFQYIKE 192

  Fly   471 IGGLEYEAEYPYKAKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINAN--AM 533
            .|||:.|..|||:||...|.:....:.....||||:|: .|.|:.:.:...||||:.::|:  ::
  Rat   193 NGGLDSEESYPYEAKDGSCKYRAEYAVANDTGFVDIPQ-QEKALMKPVATVGPISVAMDASHPSL 256

  Fly   534 QFYRGGVSHPWKALCSKKNLDHGVLVVGYGVSDY-PNFHKTLPYWIVKNSWGPRWGEQGYYRVYR 597
            |||..|:.  ::..||.|:|||||||||||.... .|..|   ||:||||||..||..||.::.:
  Rat   257 QFYSSGIY--YEPNCSSKDLDHGVLVVGYGYEGTDSNKDK---YWLVKNSWGKEWGMDGYIKIAK 316

  Fly   598 G-DNTCGVSEMATSAVL 613
            . :|.||::..|:..::
  Rat   317 DRNNHCGLATAASYPIV 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 16/60 (27%)
Peptidase_C1A 395..611 CDD:239068 103/221 (47%)
CtslNP_037288.1 Inhibitor_I29 29..87 CDD:214853 20/80 (25%)
Peptidase_C1 114..332 CDD:278538 103/223 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343573
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100116
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.640

Return to query results.
Submit another query.