DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and Ctsz

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_899159.1 Gene:Ctsz / 252929 RGDID:708479 Length:306 Species:Rattus norvegicus


Alignment Length:236 Identity:80/236 - (33%)
Similarity:112/236 - (47%) Gaps:43/236 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 ELPKEFDWRQKDAV---TQVKNQ---GSCGSCWAFSVTGNIEGLYAVK-TGELKE--FSEQELLD 448
            :|||.:|||..:.|   :..:||   ..||||||...|..:.....:| .|....  .|.|.::|
  Rat    63 DLPKNWDWRNVNGVNYASVTRNQHIPQYCGSCWAHGSTSALADRINIKRKGAWPSTLLSVQNVID 127

  Fly   449 CDTTDSACNGG----LMDNAYK-AIKDIGGLEYEAEYPYKAKKNQ---------CHF--NRTLSH 497
            |....| |.||    :.:.|:| .|.|.....|:|:.....|.||         ||.  |.||..
  Rat   128 CGNAGS-CEGGNDLPVWEYAHKHGIPDETCNNYQAKDQECDKFNQCGTCTEFKECHTIQNYTLWR 191

  Fly   498 VQVAGFVDLPKGNETAMQEWLLANGPISIGINA-NAMQFYRGGVSHPWKALCSKKNLDHGVLVVG 561
            |...|.:   .|.|..|.| :.||||||.||.| ..|..|.||:...::   ::..::|.:.|.|
  Rat   192 VGDYGSL---SGREKMMAE-IYANGPISCGIMATERMSNYTGGIYTEYQ---NQAIINHIISVAG 249

  Fly   562 YGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRV----YRG 598
            :|||     :..:.||||:||||..|||:|:.|:    |:|
  Rat   250 WGVS-----NDGIEYWIVRNSWGEPWGERGWMRIVTSTYKG 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458
Peptidase_C1A 395..611 CDD:239068 79/234 (34%)
CtszNP_899159.1 Peptidase_C1A_CathepsinX 64..305 CDD:239149 80/235 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.