DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and Ctsq

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_640355.1 Gene:Ctsq / 246147 RGDID:631421 Length:343 Species:Rattus norvegicus


Alignment Length:329 Identity:117/329 - (35%)
Similarity:178/329 - (54%) Gaps:39/329 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 VDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELN-ANEMGSAKY--GITEFADMTSSEY 365
            :|..:.::::::.:.| |..|..::..::.:|:|.||..| .|.:|...|  .|.:|||||..|:
  Rat    25 LDVQWQEWKIKYEKLY-SPEEEVLKRVVWEENVKKIELHNRENSLGKNTYTMEINDFADMTDEEF 88

  Fly   366 KE------------RTGLWQRDEAKATGGSAAVVPAYHGELPKEFDWRQKDAVTQVKNQGSCGSC 418
            |:            ...||:|    |.|........:...|||..|||.:..||:|:.||.|.||
  Rat    89 KDMIIGFQLPVHNTEKRLWKR----ALGSFFPNSWNWRDALPKFVDWRNEGYVTRVRKQGGCSSC 149

  Fly   419 WAFSVTGNIEGLYAVKTGELKEFSEQELLDCDTT--DSACNGGLMDNAYKAIKDIGGLEYEAEYP 481
            |||.|||.|||....|||:|...|.|.|:||...  :..|..|...||::.:...||||.||.||
  Rat   150 WAFPVTGAIEGQMFKKTGKLIPLSVQNLIDCSKPQGNRGCLWGNTYNAFQYVLHNGGLEAEATYP 214

  Fly   482 YKAKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGIN--ANAMQFYRGGVSHPW 544
            |:.|:..|.:|...|..::.|||.||: :|..:.:.:...|||:.|::  :::.:||:.||.|..
  Rat   215 YERKEGVCRYNPKNSSAKITGFVVLPE-SEDVLMDAVATKGPIATGVHVISSSFRFYQKGVYHEP 278

  Fly   545 KALCSKKNLDHGVLVVGYGV----SDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRG-DNTCGV 604
            |  || ..::|.|||||||.    :|..|      ||::|||||.|||.:||.::.:. :|.|.:
  Rat   279 K--CS-SYVNHAVLVVGYGFEGNETDGNN------YWLIKNSWGKRWGLRGYMKIAKDRNNHCAI 334

  Fly   605 SEMA 608
            :.:|
  Rat   335 ASLA 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 17/59 (29%)
Peptidase_C1A 395..611 CDD:239068 91/223 (41%)
CtsqNP_640355.1 PTZ00203 4..341 CDD:185513 117/329 (36%)
Inhibitor_I29 29..87 CDD:214853 17/58 (29%)
Peptidase_C1 125..342 CDD:278538 92/224 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.