DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and BC051665

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_954599.2 Gene:BC051665 / 218275 MGIID:2682300 Length:330 Species:Mus musculus


Alignment Length:347 Identity:126/347 - (36%)
Similarity:182/347 - (52%) Gaps:50/347 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 VVQA--RHTRSVE--WAEKKTHKKHSHRFDKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLK 337
            ||.|  .|..|::  |.|.||    .||                :.|....|.|.| .::..|:|
Mouse    14 VVSAAPAHDPSLDAVWEEWKT----KHR----------------KTYNMNEEAQKR-AVWENNMK 57

  Fly   338 TIEELNANEMGSAKYG----ITEFADMTSSEYKE-RTGLWQRDEAKATGGSAAVVPAYHGELPKE 397
            .| .|:..:....|:|    :..|.|:|::|::| .||.......:.|.....::    |::||.
Mouse    58 MI-GLHNEDYLKGKHGFNLEMNAFGDLTNTEFRELMTGFQSMGHKEMTIFQEPLL----GDVPKS 117

  Fly   398 FDWRQKDAVTQVKNQGSCGSCWAFSVTGNIEGLYAVKTGELKEFSEQELLDCDTT--DSACNGGL 460
            .|||....||.||:||.||||||||..|::||....|||:|...|||.|:||..:  :..|||||
Mouse   118 VDWRDHGYVTPVKDQGHCGSCWAFSAVGSLEGQIFRKTGKLVPLSEQNLMDCSWSYGNVGCNGGL 182

  Fly   461 MDNAYKAIKDIGGLEYEAEYPYKAKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPIS 525
            |:.|::.:|:..||:....|.|:|....|.::...|.|.:.|||.:|. :|.|:...:.:.||:|
Mouse   183 MELAFQYVKENRGLDTRESYAYEAWDGPCRYDPKYSAVNITGFVKVPL-SEDALMNAVASVGPVS 246

  Fly   526 IGINA--NAMQFYRGGVSHPWKALCSKKNLDHGVLVVGYG-VSDYPNFHKTLPYWIVKNSWGPRW 587
            :||:.  ::.:|||||..  ::..||..||||.||||||| .||      ...||:||||||..|
Mouse   247 VGIDTHHHSFRFYRGGTY--YEPDCSSTNLDHAVLVVGYGEESD------GRKYWLVKNSWGEDW 303

  Fly   588 GEQGYYRVYRG-DNTCGVSEMA 608
            |..||.::.:. ||.||::..|
Mouse   304 GMDGYIKMAKDRDNNCGIATYA 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 13/60 (22%)
Peptidase_C1A 395..611 CDD:239068 96/220 (44%)
BC051665NP_954599.2 PTZ00203 7..326 CDD:185513 126/347 (36%)
Inhibitor_I29 29..87 CDD:214853 19/79 (24%)
Peptidase_C1 114..329 CDD:278538 96/221 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100116
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.