DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and Y71H2AR.2

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_001367938.1 Gene:Y71H2AR.2 / 190615 WormBaseID:WBGene00022189 Length:299 Species:Caenorhabditis elegans


Alignment Length:241 Identity:84/241 - (34%)
Similarity:125/241 - (51%) Gaps:35/241 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 PAYHGELPKEF-DWRQKDAVTQVKNQGSCGSCWAFSVTGNIEGLYAVKT-GELKEFSEQELLDCD 450
            |.:.....:|| |||:|..|..||:||.|.:..||::|.:||.:||..| |.|..||||:|:||:
 Worm    75 PIHMDRTTEEFLDWREKGIVGPVKDQGKCNASHAFAITSSIESMYAKATNGTLLSFSEQQLIDCN 139

  Fly   451 TTDSACNGGLMDNAYK------AIKDIG-----GLEYEAEYPYKAKKNQ-CHFNRTLSHVQVAGF 503
                       |..||      |:..||     |:|.||:|||..|.|: |.|:.|.|.:.:...
 Worm   140 -----------DQGYKGCEEQFAMNAIGYLATHGIETEADYPYVDKTNEKCTFDSTKSKIHLKKG 193

  Fly   504 VDLPKGNETAMQEWLLANGPISIGINA-NAMQFYRGGVSHPWKALCSKKNLDHGVLVVGYGVSDY 567
            | :.:|||...:.::...||....:.| .::..|:.|:.:|....|:..:....:::||||:...
 Worm   194 V-VAEGNEVLGKVYVTNYGPAFFTMRAPPSLYDYKIGIYNPSIEECTSTHEIRSMVIVGYGIEGE 257

  Fly   568 PNFHKTLPYWIVKNSWGPRWGEQGYYRVYRGDNTCGVSEMATSAVL 613
            ..      |||||.|:|..||||||.::.|..|.|.::  .|.|||
 Worm   258 QK------YWIVKGSFGTSWGEQGYMKLARDVNACAMA--TTIAVL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458
Peptidase_C1A 395..611 CDD:239068 80/230 (35%)
Y71H2AR.2NP_001367938.1 Peptidase_C1A 84..290 CDD:239068 79/225 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D162131at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.