DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and cpr-2

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_507186.3 Gene:cpr-2 / 185355 WormBaseID:WBGene00000782 Length:326 Species:Caenorhabditis elegans


Alignment Length:310 Identity:71/310 - (22%)
Similarity:125/310 - (40%) Gaps:69/310 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   339 IEELN--ANEMGSAKYGITEFADMTSSEYKERTGLWQRDEAKATGGSAAVVPAYHGELPKEFD-- 399
            ::.:|  |:...:..|.:|.....|.|.:::....:. ||.:||.....:     ...|..||  
 Worm    32 VDHINSAASTFQTENYAVTHEKMHTRSMHEKFNAPFP-DEFRATEREFVL-----DATPLNFDAR 90

  Fly   400 --WRQKDAVTQVKNQGSCGSCWAFSVTGNIEGLYAVKTGELKE--FSEQELLDC--DTTDSACNG 458
              |.|..::..::.|.:||||||||....|.....:.:...::  .|..:||.|  .:....|:|
 Worm    91 TRWPQCKSMKLIREQSNCGSCWAFSTAEVISDRTCIASNGTQQPIISPTDLLTCCGMSCGEGCDG 155

  Fly   459 GLMDNAYKAIK------DIGGLEYEA----EYPYK-AKKNQC--------------HFNRTLSHV 498
            |.   .|:|.:      .:.|.:|..    .||.: ...:.|              .:..|.:: 
 Worm   156 GF---PYRAFQWWARRGVVTGGDYLGTGCKPYPIRPCNSDNCVNLQTPPCRLSCQPGYRTTYTN- 216

  Fly   499 QVAGFVDLPKGNE--------TAMQEWLLANGP-ISIGINANAMQFYRGGVSHPWKALCSKKNLD 554
                  |...||.        .|:|..:..||| ::..|.....:.|:.|:   ::.:..:....
 Worm   217 ------DKNYGNSAYPVPRTVAAIQADIYYNGPVVAAFIVYEDFEKYKSGI---YRHIAGRSKGG 272

  Fly   555 HGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRGDNTCGV 604
            |.|.::|:|.      .:..|||:..||||.:|||.|.:|:.||.:.||:
 Worm   273 HAVKLIGWGT------ERGTPYWLAVNSWGSQWGESGTFRILRGVDECGI 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 6/27 (22%)
Peptidase_C1A 395..611 CDD:239068 61/252 (24%)
cpr-2NP_507186.3 Peptidase_C1A_CathepsinB 84..323 CDD:239111 61/252 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.