DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and F15D4.4

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_496805.3 Gene:F15D4.4 / 184530 WormBaseID:WBGene00008861 Length:608 Species:Caenorhabditis elegans


Alignment Length:315 Identity:87/315 - (27%)
Similarity:137/315 - (43%) Gaps:58/315 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 STAERQM-RLRIFRQNLKTIEELN-ANEMGSAKYGIT--EFADMTSSEYKERTGLWQRDEAKATG 381
            |||:..: |..::.:..|.::|.| ..|:|.:.|.::  :|:.....|....|     ....|..
 Worm   146 STAKEGLKRFNVYSKVKKEVDEHNIMYELGMSSYKMSTNQFSVALDGEVAPLT-----LNLDALT 205

  Fly   382 GSAAVVPAYHGELPKE-----FDWRQKDAVTQVKNQGSCGSCWAFSVTGNIEGLYAVKTGELKEF 441
            .:|.|:||......|.     .|||  ..:..:.:|.:||.|||||:...||..:|::.......
 Worm   206 PTATVIPATISSRKKRDTEPTVDWR--PFLKPILDQSTCGGCWAFSMISMIESFFAIQGYNTSSL 268

  Fly   442 SEQELLDCDT-TDS-------ACNGGLMDNAYKAIKDIGGLEYEAEYPYKAKKNQC---HFNRTL 495
            |.|:||.||| .||       .|.||....|...: ::......:..|:..:...|   .|...:
 Worm   269 SVQQLLTCDTKVDSTYGLANVGCKGGYFQIAGSYL-EVSAARDASLIPFDLEDTSCDSSFFPPVV 332

  Fly   496 SHVQV--AGFVDLPKGNETAMQ--------EWLLANGPISIGINANA-MQFYRGGVSHPWKALCS 549
            ..:.:  .|::   .||.||.|        |..:..|||::|:.|.. :..|..||   :...|.
 Worm   333 PTILLFDDGYI---SGNFTAAQLITMEQNIEDKVRKGPIAVGMAAGPDIYKYSEGV---YDGDCG 391

  Fly   550 KKNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYR--GDNTC 602
             ..::|.|::||:          |..|||::||||..|||.||:||.|  |.:.|
 Worm   392 -TIINHAVVIVGF----------TDDYWIIRNSWGASWGEAGYFRVKRTPGKDPC 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 11/47 (23%)
Peptidase_C1A 395..611 CDD:239068 69/237 (29%)
F15D4.4NP_496805.3 Inhibitor_I29 <146..187 CDD:214853 10/40 (25%)
Peptidase_C1A 227..442 CDD:239068 68/229 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.