DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and C32B5.13

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_493866.1 Gene:C32B5.13 / 183116 WormBaseID:WBGene00016306 Length:150 Species:Caenorhabditis elegans


Alignment Length:151 Identity:45/151 - (29%)
Similarity:76/151 - (50%) Gaps:21/151 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   441 FSEQELLDCDTTDSACNGGLMDNAYKAIKDIGGLEYEAEYPYKAKKNQ-CHFNRTL-----SHVQ 499
            ||||:::||....|.|...::.:.:  ||. .|:..||:|||..|:|: |.::...     :::.
 Worm    13 FSEQQIIDCGNFTSPCQENILSHEF--IKK-NGVVTEADYPYVGKENEKCKYDENKIKLWPTNML 74

  Fly   500 VAGFVDLPKGNETAMQEWLLANGPISIGINANAMQF-YRGGVSHPWKALCSKKNLDHGVLVVGYG 563
            :.|  :||   ||.::.::..:||....:.|....| |:.|:..|.:..|.|......:.:||||
 Worm    75 LVG--NLP---ETLLKLFIKEHGPGYFRMKAPPSFFNYKTGIYSPTQEECGKATDARSLTIVGYG 134

  Fly   564 VSDYPNFHKTLPYWIVKNSWG 584
            :....|      |||||.|:|
 Worm   135 IEGGQN------YWIVKGSFG 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458
Peptidase_C1A 395..611 CDD:239068 45/151 (30%)
C32B5.13NP_493866.1 Peptidase_C1 1..150 CDD:390061 45/151 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.