DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and Y51A2D.1

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_001256811.1 Gene:Y51A2D.1 / 180204 WormBaseID:WBGene00013072 Length:314 Species:Caenorhabditis elegans


Alignment Length:359 Identity:88/359 - (24%)
Similarity:137/359 - (38%) Gaps:112/359 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 EWAEKKTHKKHSHRFDKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNANEMGSAK 351
            |:.|....:.|.   :||...|.:|:.:|.|.|.|.||.|:||:.|.::...:..||.|...:.:
 Worm    26 EFFEINIDRDHP---EKVYQEFVEFKKKFSRTYKSEAENQLRLQNFVKSRNNVVRLNKNAQKAGR 87

  Fly   352 ---YGITEFADMTSSEYKER----------TGLWQRDEAKATGGSAAVVPAYHGELPKEFDWRQK 403
               :.:.:|:|:|:||..:|          ..::.::..|..|.:.  ....:.|..:.||.|.:
 Worm    88 NSNFAVNQFSDLTTSELHQRLSRFPPNLTENSVFHKNFKKLLGKTR--TKRQNSEFARNFDLRSQ 150

  Fly   404 DA-----VTQVKNQGSCGSCWAFSVTGNIEGLYAVKTGELKEFSEQELLDCDTTDSACNGGLMDN 463
            ..     |..:||||.|..||.|:||..:|.:|||..|..|                        
 Worm   151 KVNGRYIVGPIKNQGQCACCWGFAVTAMLETIYAVNVGRFK------------------------ 191

  Fly   464 AYKAIKDIGGLEYEAEYPYKAKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQE----WLLANGPI 524
                                 :|...||.|             |:..|:.:.|    |   ..|:
 Worm   192 ---------------------RKLDYHFIR-------------PENAESEIIEILNTW---KTPV 219

  Fly   525 SIGINA-NAMQFYRGGV---------SHPWKALCSKKNLDHGVLVVGYG-VSDYPNFHKTLPYWI 578
            ::...| .|...|:.||         ...|          |...:|||| .:|...  ::..:||
 Worm   220 AVYFAAGTAFLQYKSGVLVTEDCDLAGTVW----------HAGAIVGYGEENDLRG--RSQRFWI 272

  Fly   579 VKNSWG-PRWGEQGYYRVYRGDNTCGVSEMATSA 611
            :||||| ..||..||.::.||.|.||:...|..|
 Worm   273 MKNSWGVSGWGTGGYVKLIRGKNWCGIERGAIGA 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 19/59 (32%)
Peptidase_C1A 395..611 CDD:239068 58/236 (25%)
Y51A2D.1NP_001256811.1 Inhibitor_I29 44..103 CDD:214853 18/58 (31%)
Peptidase_C1A 144..303 CDD:239068 57/231 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.