DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and cpl-1

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_001256718.1 Gene:cpl-1 / 180111 WormBaseID:WBGene00000776 Length:337 Species:Caenorhabditis elegans


Alignment Length:347 Identity:133/347 - (38%)
Similarity:195/347 - (56%) Gaps:43/347 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 VVQARHTRSVEWAEKKTHKKHSHRFDKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEE 341
            |..|:.:|.:|.|.:|               :..::..|.:.| |.:|.|..:..|.:|:..||.
 Worm    16 VNSAKLSRQIESAIEK---------------WDDYKEDFDKEY-SESEEQTYMEAFVKNMIHIEN 64

  Fly   342 LNA-NEMGSAKY--GITEFADMTSSEYKERTGLWQR--DEAKATGGSAAVVPAYHGELPKEFDWR 401
            .|. :.:|...:  |:...||:..|:|::..| ::|  .:::....|:.:.| ::.::|.|.|||
 Worm    65 HNRDHRLGRKTFEMGLNHIADLPFSQYRKLNG-YRRLFGDSRIKNSSSFLAP-FNVQVPDEVDWR 127

  Fly   402 QKDAVTQVKNQGSCGSCWAFSVTGNIEGLYAVKTGELKEFSEQELLDCDTT--DSACNGGLMDNA 464
            ....||.|||||.||||||||.||.:||.:|.|.|:|...|||.|:||.|.  :..|||||||.|
 Worm   128 DTHLVTDVKNQGMCGSCWAFSATGALEGQHARKLGQLVSLSEQNLVDCSTKYGNHGCNGGLMDQA 192

  Fly   465 YKAIKDIGGLEYEAEYPYKAKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGIN 529
            ::.|:|..|::.|..||||.:..:||||:........|:||.|:|:|..::..:...|||||.|:
 Worm   193 FEYIRDNHGVDTEESYPYKGRDMKCHFNKKTVGADDKGYVDTPEGDEEQLKIAVATQGPISIAID 257

  Fly   530 A--NAMQFYRGGVSHPWKALCSKKNLDHGVLVVGYGVSDYPNFHKTLP----YWIVKNSWGPRWG 588
            |  .:.|.|:.||.:..:  ||.:.||||||:||||         |.|    |||||||||..||
 Worm   258 AGHRSFQLYKKGVYYDEE--CSSEELDHGVLLVGYG---------TDPEHGDYWIVKNSWGAGWG 311

  Fly   589 EQGYYRVYRG-DNTCGVSEMAT 609
            |:||.|:.|. :|.|||:..|:
 Worm   312 EKGYIRIARNRNNHCGVATKAS 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 15/59 (25%)
Peptidase_C1A 395..611 CDD:239068 107/224 (48%)
cpl-1NP_001256718.1 Inhibitor_I29 32..91 CDD:369782 15/59 (25%)
Peptidase_C1 120..335 CDD:365882 107/225 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100116
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.