DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and F32H5.1

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_506310.1 Gene:F32H5.1 / 179815 WormBaseID:WBGene00009347 Length:356 Species:Caenorhabditis elegans


Alignment Length:368 Identity:69/368 - (18%)
Similarity:110/368 - (29%) Gaps:169/368 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   358 ADMTSSEYKERTGLWQ-----------------------RDE-AKATGGSAAVVPAYHGELPKEF 398
            :|:||...|::. ||:                       .|| ::.||....:|     ::|..|
 Worm    38 SDLTSYVNKKQK-LWKAETSRMTFQEKMARAKSIKFIKSNDEVSEKTGNDNVLV-----DIPSSF 96

  Fly   399 DWRQK----DAVTQVKNQGSCGS--------------CWAFSVTGNIEGLYAVKTGELKEFSEQE 445
            |.|||    ..:..|::|..|||              |.|.:.|.|            ...|.|:
 Worm    97 DSRQKWPSCSQIGAVRDQSDCGSAAHLVAVEIASDRTCIASNGTFN------------WPLSAQD 149

  Fly   446 LLDCDT-------------------------TDSACNGGLMDNAYKAIKDIGGLEYEAEYPYKAK 485
            .|.|..                         |...|.||..::.:       |.:..:.||...|
 Worm   150 PLSCCVGLMSICGDGWGCDGSWPKDILKWWQTHGLCTGGNYNDQF-------GCKPYSIYPCDKK 207

  Fly   486 --------------------------------KNQCHFNRTLSHVQVAGFVDLPKGNE-TAMQEW 517
                                            |...||.:  :|..|        |.: |.:|..
 Worm   208 YANGTTSVPCPGYHTPTCEEHCTSNITWPIAYKQDKHFGK--AHYNV--------GKKMTDIQIE 262

  Fly   518 LLANGPI-------------SIGINANAMQFYRGGVSHPWKALCSKKNLDHGVLVVGYGVSDYPN 569
            ::.|||:             ..||..:......||:.               ..::|:||.:   
 Worm   263 IMTNGPVIASFIIYDDFWDYKTGIYVHTAGDQEGGMD---------------TKIIGWGVDN--- 309

  Fly   570 FHKTLPYWIVKNSWGPRWGEQGYYRVYRGDNTCGVSEMATSAV 612
               .:|||:..:.||..:||.|:.|..||.|...:.....:|:
 Worm   310 ---GVPYWLCVHQWGTDFGENGFVRFLRGVNEVNIEHQVLAAL 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 3/6 (50%)
Peptidase_C1A 395..611 CDD:239068 57/304 (19%)
F32H5.1NP_506310.1 Peptidase_C1A_CathepsinB 93..348 CDD:239111 57/304 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.