Sequence 1: | NP_730901.1 | Gene: | CG12163 / 40628 | FlyBaseID: | FBgn0260462 | Length: | 614 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_503382.1 | Gene: | W07B8.4 / 178611 | WormBaseID: | WBGene00021072 | Length: | 335 | Species: | Caenorhabditis elegans |
Alignment Length: | 272 | Identity: | 67/272 - (24%) |
---|---|---|---|
Similarity: | 115/272 - (42%) | Gaps: | 69/272 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 394 LPKEFD----WRQKDAVTQVKNQGSCGSCWAFSVTGNIEGLYAV-KTGELKE-FSEQELLDCDT- 451
Fly 452 ---TDSACNGGLMDNAYKA-IKD--IGGLEYEAEY---PYKAKKNQCHFNRTLSHV-------QV 500
Fly 501 AGFVDLPK------GNET-----------------------AMQEWLLANGPISIG-INANAMQF 535
Fly 536 YRGGVSHPWKALCSKKNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRGDN 600
Fly 601 TCGVSEMATSAV 612 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12163 | NP_730901.1 | CY | 194..272 | CDD:298856 | |
Inhibitor_I29 | 308..365 | CDD:285458 | |||
Peptidase_C1A | 395..611 | CDD:239068 | 67/268 (25%) | ||
W07B8.4 | NP_503382.1 | Peptidase_C1A_CathepsinB | 74..327 | CDD:239111 | 67/268 (25%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG4870 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |