DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and Y65B4A.2

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_001293246.1 Gene:Y65B4A.2 / 171655 WormBaseID:WBGene00022026 Length:448 Species:Caenorhabditis elegans


Alignment Length:390 Identity:86/390 - (22%)
Similarity:141/390 - (36%) Gaps:126/390 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 FYKFQVRFGRRYVSTA------ERQMRLRIFRQ---NLKTIEELNANEMG--SAKYGITEFADMT 361
            ||.:     ||||:.|      :..:| ::.||   :.:|..:...|:.|  :..||.....:.|
 Worm    74 FYLY-----RRYVTDANDKRDNDEYLR-KLVRQVNDSPETTWKAKFNKFGVKNRSYGFKYTRNQT 132

  Fly   362 S-SEYKER------TGLWQR--DEAKATGGSAAVVPAYHGELPKEFDWRQK----DAVTQVKNQG 413
            : .||.|:      :...:|  ||.:....|         ::||.||.|||    .:::.|.|||
 Worm   133 AVEEYVEQIRKFFESDAMKRHLDELENFNSS---------DVPKNFDARQKWPNCPSISNVPNQG 188

  Fly   414 SCGSCWAFSVTGNIEGLYAV-KTGELKE-FSEQELLDCDTTDSACNGGLMDNAYKAIK------- 469
            .||||:|.:..|.......: ..|..|. .||::::.|.:....|.||   :..||:.       
 Worm   189 GCGSCFAVAAAGVASDRACIHSNGTFKSLLSEEDIIGCCSVCGNCYGG---DPLKALTYWVNQGL 250

  Fly   470 DIGGLE--------------------YEAE-------------YPYKAKKNQCHFNRTLSHVQVA 501
            ..||.:                    :|||             |..|.:::: ||......:...
 Worm   251 VTGGRDGCRPYSFDLSCGVPCSPATFFEAEEKRTCMKRCQNIYYQQKYEEDK-HFATFAYSMYPR 314

  Fly   502 GFVDLPKGNETA-------------------------MQEWLLANGPISIGINA-NAMQFYRGGV 540
            .....|.|.|..                         :::.:|..||.::.... .....|..||
 Worm   315 SMTVSPDGKERVKVPTIIGHFNDKKTEKLNVTEYRDIIKKEILLYGPTTMAFPVPEEFLHYSSGV 379

  Fly   541 SHPWKALCSKKNLD------HGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRGD 599
            ..|:..    ...|      |.|.::|:|.|| ...|    ||:..||:|..||:.|.:::...|
 Worm   380 FRPYPT----DGFDDRIVYWHVVRLIGWGESD-DGTH----YWLAVNSFGNHWGDNGLFKINTDD 435

  Fly   600  599
             Worm   436  435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 16/68 (24%)
Peptidase_C1A 395..611 CDD:239068 63/283 (22%)
Y65B4A.2NP_001293246.1 Peptidase_C1A_CathepsinB 166..444 CDD:239111 63/283 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.