DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and Kng1

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_001095881.1 Gene:Kng1 / 16644 MGIID:1097705 Length:661 Species:Mus musculus


Alignment Length:403 Identity:72/403 - (17%)
Similarity:115/403 - (28%) Gaps:187/403 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DAESTESSETTTDQAVSE------------------------PPITLVHVLNPGEREYLSPNLIG 74
            |||...:.|.|......|                        |.|..||.::..     ||:|..
Mouse    98 DAEEAATGECTATVGKRENEFFIVTQTCKIAPSKAPILKAYFPCIGCVHAISTD-----SPDLEP 157

  Fly    75 VQNIAMTFLPLSMNFVN-------------IIDAFREITAGVRYEILLNALDTKAIQPAEADIVC 126
            |       |..|:...|             :..|.|::.||:.::|...                
Mouse   158 V-------LKHSIEHFNNNTDHSHLFTLRKVKSAHRQVVAGLNFDITYT---------------- 199

  Fly   127 RLVILEKPWLRTQWGDKHRELVTSNCTDPAVNSVAGDPAE---------KARL---LNEKYVHRS 179
                                :|.:||:.....|:.||...         :..|   :|.|..:.|
Mouse   200 --------------------IVQTNCSKERFPSLHGDCVALPNGDDGECRGNLFMDINNKIANFS 244

  Fly   180 RR----SANDIL----------GRHKPYDEEAAKAQLQKSLDKLTAGEGPH---YKIVKVYSASR 227
            :.    |.:|::          .|..|.|....|..|..|:.:|.| |..|   |||..|..|:.
Mouse   245 QSCTLYSGDDLVEALPKPCPGCPRDIPVDSPELKEVLGHSIAQLNA-ENDHPFYYKIDTVKKATS 308

  Fly   228 QVDSGILTRID-------------ADLIDGSEEQH-----RCIVDIWTKVWVRKDEHEI--TFKC 272
            ||.:|....|:             .:|.:..|.:|     .|..:::.:.|    |:::  |.||
Mouse   309 QVVAGTKYVIEFIARETKCSKESNTELAEDCEIKHLGQSLDCNANVYMRPW----ENKVVPTVKC 369

  Fly   273 ------------------RNQPVVQARHTRSVE------------------------WAEK---- 291
                              |:..|.:.:..|:|.                        |..:    
Mouse   370 QALDMTEMARRPPGFSPFRSVTVQETKEGRTVSPPYIAREQEERDAETEQGPTHGHGWLHEKQIK 434

  Fly   292 --KTHKKHSHRFD 302
              |.|:.|.|..|
Mouse   435 ANKNHRGHKHGHD 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856 24/100 (24%)
Inhibitor_I29 308..365 CDD:285458
Peptidase_C1A 395..611 CDD:239068
Kng1NP_001095881.1 CY 23..126 CDD:214484 6/27 (22%)
CY 141..248 CDD:214484 25/154 (16%)
CY 263..370 CDD:214484 27/111 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 405..471 6/43 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 485..583
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 626..661
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.