DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and CTSW

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_001326.3 Gene:CTSW / 1521 HGNCID:2546 Length:376 Species:Homo sapiens


Alignment Length:326 Identity:112/326 - (34%)
Similarity:176/326 - (53%) Gaps:28/326 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 FYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNANEMGSAKYGITEFADMTSSEYKERTGLW 372
            |..||::|.|.|:|..|...||.||..||...:.|...::|:|::|:|.|:|:|..|:.:..|. 
Human    42 FKLFQIQFNRSYLSPEEHAHRLDIFAHNLAQAQRLQEEDLGTAEFGVTPFSDLTEEEFGQLYGY- 105

  Fly   373 QRDEAKATGGSAAVVPAYHGELPKE-----FDWRQ-KDAVTQVKNQGSCGSCWAFSVTGNIEGLY 431
                .:|.||..::......|.|:|     .|||: ..|::.:|:|.:|..|||.:..||||.|:
Human   106 ----RRAAGGVPSMGREIRSEEPEESVPFSCDWRKVASAISPIKDQKNCNCCWAMAAAGNIETLW 166

  Fly   432 AVKTGELKEFSEQELLDCDTTDSACNGGLMDNAYKAIKDIGGLEYEAEYPY--KAKKNQCHFNRT 494
            .:...:..:.|.||||||......|:||.:.:|:..:.:..||..|.:||:  |.:.::||..:.
Human   167 RISFWDFVDVSVQELLDCGRCGDGCHGGFVWDAFITVLNNSGLASEKDYPFQGKVRAHRCHPKKY 231

  Fly   495 LSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINANAMQFYRGGVSHPWKALCSKKNLDHGVLV 559
            .....:..|:.| :.||..:.::|...|||::.||...:|.||.||.......|..:.:||.||:
Human   232 QKVAWIQDFIML-QNNEHRIAQYLATYGPITVTINMKPLQLYRKGVIKATPTTCDPQLVDHSVLL 295

  Fly   560 VGYG------------VS--DYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRGDNTCGVSEMATS 610
            ||:|            ||  ..|......||||:|||||.:|||:||:|::||.||||:::...:
Human   296 VGFGSVKSEEGIWAETVSSQSQPQPPHPTPYWILKNSWGAQWGEKGYFRLHRGSNTCGITKFPLT 360

  Fly   611 A 611
            |
Human   361 A 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 22/56 (39%)
Peptidase_C1A 395..611 CDD:239068 83/237 (35%)
CTSWNP_001326.3 Inhibitor_I29 42..98 CDD:214853 22/55 (40%)
Peptidase_C1A 129..358 CDD:239068 81/229 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11246
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1264766at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.