DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and CTSS

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_004070.3 Gene:CTSS / 1520 HGNCID:2545 Length:331 Species:Homo sapiens


Alignment Length:322 Identity:115/322 - (35%)
Similarity:172/322 - (53%) Gaps:32/322 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 HRFDKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELN-ANEMGSAKY--GITEFADM 360
            |:...:||.::.::..:|::|....|..:|..|:.:|||.:...| .:.||...|  |:....||
Human    19 HKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSMGMHSYDLGMNHLGDM 83

  Fly   361 TSSEYKER------TGLWQRDEAKATGGSAAVVPAYHGELPKEFDWRQKDAVTQVKNQGSCGSCW 419
            ||.|....      ...|||:....:..:..        ||...|||:|..||:||.|||||:||
Human    84 TSEEVMSLMSSLRVPSQWQRNITYKSNPNRI--------LPDSVDWREKGCVTEVKYQGSCGACW 140

  Fly   420 AFSVTGNIEGLYAVKTGELKEFSEQELLDCDTT---DSACNGGLMDNAYKAIKDIGGLEYEAEYP 481
            |||..|.:|....:|||:|...|.|.|:||.|.   :..||||.|..|::.|.|..|::.:|.||
Human   141 AFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYP 205

  Fly   482 YKAKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINANAMQF--YRGGVSHPW 544
            |||...:|.::........:.:.:||.|.|..::|.:...||:|:|::|....|  ||.||.  :
Human   206 YKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVY--Y 268

  Fly   545 KALCSKKNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRG-DNTCGVS 605
            :..|: :|::|||||||||..:...      ||:||||||..:||:||.|:.|. .|.||::
Human   269 EPSCT-QNVNHGVLVVGYGDLNGKE------YWLVKNSWGHNFGEEGYIRMARNKGNHCGIA 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 17/59 (29%)
Peptidase_C1A 395..611 CDD:239068 90/217 (41%)
CTSSNP_004070.3 PTZ00203 5..326 CDD:185513 115/322 (36%)
Inhibitor_I29 28..87 CDD:214853 17/58 (29%)
Peptidase_C1 115..329 CDD:278538 91/218 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100116
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.