DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and CTSK

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_000387.1 Gene:CTSK / 1513 HGNCID:2536 Length:329 Species:Homo sapiens


Alignment Length:330 Identity:117/330 - (35%)
Similarity:176/330 - (53%) Gaps:41/330 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 WAEKKTHKKHSHRFDKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLK--TIEELNANEMGSA 350
            |  ||||:|..:  :|||.:                   .|..|:.:|||  :|..|.|: :|..
Human    29 W--KKTHRKQYN--NKVDEI-------------------SRRLIWEKNLKYISIHNLEAS-LGVH 69

  Fly   351 KY--GITEFADMTSSEYKER-TGLWQRDEAKATGGSAAVVPAYHGELPKEFDWRQKDAVTQVKNQ 412
            .|  .:....||||.|..:: ||| :...:.:.......:|.:.|..|...|:|:|..||.||||
Human    70 TYELAMNHLGDMTSEEVVQKMTGL-KVPLSHSRSNDTLYIPEWEGRAPDSVDYRKKGYVTPVKNQ 133

  Fly   413 GSCGSCWAFSVTGNIEGLYAVKTGELKEFSEQELLDCDTTDSACNGGLMDNAYKAIKDIGGLEYE 477
            |.||||||||..|.:||....|||:|...|.|.|:||.:.:..|.||.|.||::.::...|::.|
Human   134 GQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSE 198

  Fly   478 AEYPYKAKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINAN--AMQFYRGGV 540
            ..|||..::..|.:|.|....:..|:.::|:|||.|::..:...||:|:.|:|:  :.|||..||
Human   199 DAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGV 263

  Fly   541 SHPWKALCSKKNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRG-DNTCGV 604
            .  :...|:..||:|.||.||||:      .|...:||:|||||..||.:||..:.|. :|.||:
Human   264 Y--YDESCNSDNLNHAVLAVGYGI------QKGNKHWIIKNSWGENWGNKGYILMARNKNNACGI 320

  Fly   605 SEMAT 609
            :.:|:
Human   321 ANLAS 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 14/60 (23%)
Peptidase_C1A 395..611 CDD:239068 88/218 (40%)
CTSKNP_000387.1 Inhibitor_I29 26..85 CDD:214853 23/79 (29%)
Peptidase_C1 115..327 CDD:306594 88/219 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100116
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.