DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and CTSH

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_004381.2 Gene:CTSH / 1512 HGNCID:2535 Length:335 Species:Homo sapiens


Alignment Length:321 Identity:107/321 - (33%)
Similarity:161/321 - (50%) Gaps:32/321 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 DKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNANEMG--SAKYGITEFADMTSSE 364
            :.::...:|..:...|:..||.|...||:.|..|.:   ::||:..|  :.|..:.:|:||:.:|
Human    28 NSLEKFHFKSWMSKHRKTYSTEEYHHRLQTFASNWR---KINAHNNGNHTFKMALNQFSDMSFAE 89

  Fly   365 YKERTGLWQRDEAKATGGSAAVVPAY---HGELPKEFDWRQK-DAVTQVKNQGSCGSCWAFSVTG 425
            .|.:. ||...:     ..:|....|   .|..|...|||:| :.|:.|||||:|||||.||.||
Human    90 IKHKY-LWSEPQ-----NCSATKSNYLRGTGPYPPSVDWRKKGNFVSPVKNQGACGSCWTFSTTG 148

  Fly   426 NIEGLYAVKTGELKEFSEQELLDC--DTTDSACNGGLMDNAYKAIKDIGGLEYEAEYPYKAKKNQ 488
            .:|...|:.||::...:||:|:||  |..:..|.|||...|::.|....|:..|..|||:.|...
Human   149 ALESAIAIATGKMLSLAEQQLVDCAQDFNNHGCQGGLPSQAFEYILYNKGIMGEDTYPYQGKDGY 213

  Fly   489 CHFNRTLSHVQVAGFV----DLPKGNETAMQEWLLANGPISIGINANA-MQFYRGGVSHPWKALC 548
            |.|...    :..|||    ::...:|.||.|.:....|:|....... ...||.|:........
Human   214 CKFQPG----KAIGFVKDVANITIYDEEAMVEAVALYNPVSFAFEVTQDFMMYRTGIYSSTSCHK 274

  Fly   549 SKKNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRGDNTCGVSEMAT 609
            :...::|.||.||||..:      .:|||||||||||:||..||:.:.||.|.||::..|:
Human   275 TPDKVNHAVLAVGYGEKN------GIPYWIVKNSWGPQWGMNGYFLIERGKNMCGLAACAS 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 16/58 (28%)
Peptidase_C1A 395..611 CDD:239068 84/223 (38%)
CTSHNP_004381.2 Inhibitor_I29 35..90 CDD:285458 16/57 (28%)
Peptidase_C1 117..332 CDD:278538 84/223 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.