DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and Ctsw

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_034115.2 Gene:Ctsw / 13041 MGIID:1338045 Length:371 Species:Mus musculus


Alignment Length:324 Identity:116/324 - (35%)
Similarity:181/324 - (55%) Gaps:17/324 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 KVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNANEMGSAKYGITEFADMTSSEYKE 367
            ::..:|..||:||.|.|.:.||...||.||..||...:.|...::|:|::|.|.|:|:|..|:.:
Mouse    35 ELKEVFKLFQIRFNRSYWNPAEYTRRLSIFAHNLAQAQRLQQEDLGTAEFGETPFSDLTEEEFGQ 99

  Fly   368 RTGLWQRDEAKATGGSAAVVPAYHGE-LPKEFDWRQ-KDAVTQVKNQGSCGSCWAFSVTGNIEGL 430
            ..| .:|...:....:..|.....|| :|:..|||: |:.::.|||||||..|||.:...||:.|
Mouse   100 LYG-QERSPERTPNMTKKVESNTWGESVPRTCDWRKAKNIISSVKNQGSCKCCWAMAAADNIQAL 163

  Fly   431 YAVKTGELKEFSEQELLDCDTTDSACNGGLMDNAYKAIKDIGGLEYEAEYPYKA--KKNQCHFNR 493
            :.:|..:..:.|.||||||:...:.||||.:.:||..:.:..||..|.:||::.  |.::|...:
Mouse   164 WRIKHQQFVDVSVQELLDCERCGNGCNGGFVWDAYLTVLNNSGLASEKDYPFQGDRKPHRCLAKK 228

  Fly   494 TLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINANAMQFYRGGVSHPWKALCSKKNLDHGVL 558
            ......:..|..| ..||.|:..:|..:|||::.||...:|.|:.||.....:.|..:.:||.||
Mouse   229 YKKVAWIQDFTML-SNNEQAIAHYLAVHGPITVTINMKLLQHYQKGVIKATPSSCDPRQVDHSVL 292

  Fly   559 VVGYG-----------VSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRGDNTCGVSEMATSA 611
            :||:|           :|.......:.||||:|||||..|||:||:|:|||:|||||::...:|
Mouse   293 LVGFGKEKEGMQTGTVLSHSRKRRHSSPYWILKNSWGAHWGEKGYFRLYRGNNTCGVTKYPFTA 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 23/56 (41%)
Peptidase_C1A 395..611 CDD:239068 86/229 (38%)
CtswNP_034115.2 Inhibitor_I29 40..96 CDD:214853 23/55 (42%)
Peptidase_C1 126..356 CDD:278538 86/230 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11410
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1264766at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.