DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and Ctss

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_001254624.2 Gene:Ctss / 13040 MGIID:107341 Length:341 Species:Mus musculus


Alignment Length:332 Identity:125/332 - (37%)
Similarity:173/332 - (52%) Gaps:52/332 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 WAEKKTHKKHSHRFDKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNAN-EMGSAK 351
            |  ||||:|                     .|....|.::|..|:.:|||.|...|.. .||...
Mouse    40 W--KKTHEK---------------------EYKDKNEEEVRRLIWEKNLKFIMIHNLEYSMGMHT 81

  Fly   352 Y--GITEFADMTSSEYKERTGLWQ--RDEAKATGGSAAVVPAYHGE-LPKEFDWRQKDAVTQVKN 411
            |  |:.:..|||:.|...|.|..:  |...|     .....:|... ||...|||:|..||:||.
Mouse    82 YQVGMNDMGDMTNEEILCRMGALRIPRQSPK-----TVTFRSYSNRTLPDTVDWREKGCVTEVKY 141

  Fly   412 QGSCGSCWAFSVTGNIEGLYAVKTGELKEFSEQELLDCDTTD----SACNGGLMDNAYKAIKDIG 472
            |||||:|||||..|.:||...:|||:|...|.|.|:||...:    ..|.||.|..|::.|.|.|
Mouse   142 QGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNG 206

  Fly   473 GLEYEAEYPYKAKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINA--NAMQF 535
            |:|.:|.|||||...:||:|........:.::.||.|:|.|::|.:...||:|:||:|  ::..|
Mouse   207 GIEADASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFF 271

  Fly   536 YRGGV-SHPWKALCSKKNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRGD 599
            |:.|| ..|   .|: .|::|||||||||..|..:      ||:||||||..:|:|||.|:.|.:
Mouse   272 YKSGVYDDP---SCT-GNVNHGVLVVGYGTLDGKD------YWLVKNSWGLNFGDQGYIRMARNN 326

  Fly   600 -NTCGVS 605
             |.||::
Mouse   327 KNHCGIA 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 16/59 (27%)
Peptidase_C1A 395..611 CDD:239068 96/219 (44%)
CtssNP_001254624.2 Inhibitor_I29 37..96 CDD:214853 22/78 (28%)
Peptidase_C1 124..339 CDD:278538 97/220 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100116
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.