DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and Ctsl

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_034114.1 Gene:Ctsl / 13039 MGIID:88564 Length:334 Species:Mus musculus


Alignment Length:342 Identity:130/342 - (38%)
Similarity:190/342 - (55%) Gaps:43/342 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 TRSVEWAE-KKTHKKHSHRFDKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNANE 346
            |.|.||.: |.||                      ||...|.|.:.|..|:.:|::.| :|:..|
Mouse    24 TFSAEWHQWKSTH----------------------RRLYGTNEEEWRRAIWEKNMRMI-QLHNGE 65

  Fly   347 MGSAKYG----ITEFADMTSSEYKERTGLWQRDEAKATGGSAAVVPAYHGELPKEFDWRQKDAVT 407
            ..:.::|    :..|.|||:.|:::....::..:.|.  |.....|... ::||..|||:|..||
Mouse    66 YSNGQHGFSMEMNAFGDMTNEEFRQVVNGYRHQKHKK--GRLFQEPLML-KIPKSVDWREKGCVT 127

  Fly   408 QVKNQGSCGSCWAFSVTGNIEGLYAVKTGELKEFSEQELLDCDTT--DSACNGGLMDNAYKAIKD 470
            .|||||.||||||||.:|.:||...:|||:|...|||.|:||...  :..|||||||.|::.||:
Mouse   128 PVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKE 192

  Fly   471 IGGLEYEAEYPYKAKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINAN--AM 533
            .|||:.|..|||:||...|.:....:.....||||:|: .|.|:.:.:...||||:.::|:  ::
Mouse   193 NGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQ-QEKALMKAVATVGPISVAMDASHPSL 256

  Fly   534 QFYRGGVSHPWKALCSKKNLDHGVLVVGYGVSDY-PNFHKTLPYWIVKNSWGPRWGEQGYYRVYR 597
            |||..|:.  ::..||.||||||||:||||.... .|.:|   ||:||||||..||.:||.::.:
Mouse   257 QFYSSGIY--YEPNCSSKNLDHGVLLVGYGYEGTDSNKNK---YWLVKNSWGSEWGMEGYIKIAK 316

  Fly   598 G-DNTCGVSEMATSAVL 613
            . ||.||::..|:..|:
Mouse   317 DRDNHCGLATAASYPVV 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 15/60 (25%)
Peptidase_C1A 395..611 CDD:239068 103/221 (47%)
CtslNP_034114.1 Inhibitor_I29 29..87 CDD:214853 19/80 (24%)
Peptidase_C1 114..331 CDD:365882 103/222 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100116
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.