DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and Ctsb

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_031824.1 Gene:Ctsb / 13030 MGIID:88561 Length:339 Species:Mus musculus


Alignment Length:266 Identity:70/266 - (26%)
Similarity:108/266 - (40%) Gaps:61/266 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 ELPKEFD----WRQKDAVTQVKNQGSCGSCWAFSVTGNIEGLYAVKT-GELK-EFSEQELLDC-- 449
            :||:.||    |.....:.|:::||||||||||.....|.....:.| |.:. |.|.::||.|  
Mouse    79 DLPETFDAREQWSNCPTIGQIRDQGSCGSCWAFGAVEAISDRTCIHTNGRVNVEVSAEDLLTCCG 143

  Fly   450 DTTDSACNGGLMDNAY-----KAIKDIGGLEYEAE---YPYKAKKNQCHFNRTLSHVQVAGFVDL 506
            ......||||....|:     |.:  :.|..|.:.   .||.....:.|.|.  |.....|..|.
Mouse   144 IQCGDGCNGGYPSGAWSFWTKKGL--VSGGVYNSHVGCLPYTIPPCEHHVNG--SRPPCTGEGDT 204

  Fly   507 PKGNETA----------------------------MQEWLLANGPISIGINANAMQF--YRGGVS 541
            |:.|::.                            |.| :..|||:. |.......|  |:.|| 
Mouse   205 PRCNKSCEAGYSPSYKEDKHFGYTSYSVSNSVKEIMAE-IYKNGPVE-GAFTVFSDFLTYKSGV- 266

  Fly   542 HPWKALCSKKNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRGDNTCGVSE 606
              :|.........|.:.::|:||.:      .:|||:..|||...||:.|::::.||:|.||:..
Mouse   267 --YKHEAGDMMGGHAIRILGWGVEN------GVPYWLAANSWNLDWGDNGFFKILRGENHCGIES 323

  Fly   607 MATSAV 612
            ...:.:
Mouse   324 EIVAGI 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458
Peptidase_C1A 395..611 CDD:239068 69/261 (26%)
CtsbNP_031824.1 Propeptide_C1 26..65 CDD:285358
Peptidase_C1A_CathepsinB 81..328 CDD:239111 69/261 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.