Sequence 1: | NP_730901.1 | Gene: | CG12163 / 40628 | FlyBaseID: | FBgn0260462 | Length: | 614 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_031824.1 | Gene: | Ctsb / 13030 | MGIID: | 88561 | Length: | 339 | Species: | Mus musculus |
Alignment Length: | 266 | Identity: | 70/266 - (26%) |
---|---|---|---|
Similarity: | 108/266 - (40%) | Gaps: | 61/266 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 393 ELPKEFD----WRQKDAVTQVKNQGSCGSCWAFSVTGNIEGLYAVKT-GELK-EFSEQELLDC-- 449
Fly 450 DTTDSACNGGLMDNAY-----KAIKDIGGLEYEAE---YPYKAKKNQCHFNRTLSHVQVAGFVDL 506
Fly 507 PKGNETA----------------------------MQEWLLANGPISIGINANAMQF--YRGGVS 541
Fly 542 HPWKALCSKKNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRGDNTCGVSE 606
Fly 607 MATSAV 612 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12163 | NP_730901.1 | CY | 194..272 | CDD:298856 | |
Inhibitor_I29 | 308..365 | CDD:285458 | |||
Peptidase_C1A | 395..611 | CDD:239068 | 69/261 (26%) | ||
Ctsb | NP_031824.1 | Propeptide_C1 | 26..65 | CDD:285358 | |
Peptidase_C1A_CathepsinB | 81..328 | CDD:239111 | 69/261 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG4870 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |