DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and Ctla2b

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_031823.1 Gene:Ctla2b / 13025 MGIID:88555 Length:113 Species:Mus musculus


Alignment Length:83 Identity:24/83 - (28%)
Similarity:36/83 - (43%) Gaps:24/83 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 EWAEKKTHKKHSHRFDKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNAN-EMGSA 350
            ||.|.||                    .|.:.|....||..|| ::.:|.|.||..||: |.|..
Mouse    15 EWKEWKT--------------------TFAKAYSLDEERHRRL-MWEENKKKIEAHNADYERGKT 58

  Fly   351 KY--GITEFADMTSSEYK 366
            .:  |:.:|:|:|..|::
Mouse    59 SFYMGLNQFSDLTPEEFR 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 18/59 (31%)
Peptidase_C1A 395..611 CDD:239068
Ctla2bNP_031823.1 2 X 3 AA tandem repeats of E-W-K 15..20 3/4 (75%)
Inhibitor_I29 16..74 CDD:214853 22/78 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.