DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsF and Ctla2a

DIOPT Version :10

Sequence 1:NP_730901.1 Gene:CtsF / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_031822.2 Gene:Ctla2a / 13024 MGIID:88554 Length:137 Species:Mus musculus


Alignment Length:83 Identity:25/83 - (30%)
Similarity:37/83 - (44%) Gaps:24/83 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 EWAEKKTHKKHSHRFDKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNAN-EMGSA 350
            ||.|.||                    :|.:.|....||..|| ::.:|.|.||..||: |.|..
Mouse    39 EWKEWKT--------------------KFAKAYNLNEERHRRL-VWEENKKKIEAHNADYEQGKT 82

  Fly   351 KY--GITEFADMTSSEYK 366
            .:  |:.:|:|:|..|:|
Mouse    83 SFYMGLNQFSDLTPEEFK 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsFNP_730901.1 Inhibitor_I29 308..365 CDD:462410 18/59 (31%)
Peptidase_C1A 395..611 CDD:239068
Ctla2aNP_031822.2 2 X 3 AA tandem repeats of E-W-K 39..44 3/4 (75%)
Inhibitor_I29 40..98 CDD:214853 22/78 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..137
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.