DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and AgaP_AGAP004531

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:XP_313831.5 Gene:AgaP_AGAP004531 / 1274676 VectorBaseID:AGAP004531 Length:375 Species:Anopheles gambiae


Alignment Length:334 Identity:78/334 - (23%)
Similarity:135/334 - (40%) Gaps:60/334 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 FYKFQVRFGRRYVSTAERQMRLRIFRQ---NLKT-----IEELNANEMGSAKYGITEFADMTSSE 364
            :|:....:|.|:..::  ......||.   |:.|     :|.:| |...:.|.|:.   ...:.:
Mosquito    45 YYRDSASYGSRFADSS--SFAPEFFRTGYGNVLTSQAAFVEAIN-NRSTTWKAGVN---PQRNDQ 103

  Fly   365 YKERTGLWQRDEAKATGGSAAVVPAYHGELPKEFDWRQK----DAVTQVKNQGSCGSCWAFSVTG 425
            |  |||:...:..|.......|:......||..||.|||    .::..|:|||.|.|.:|.:...
Mosquito   104 Y--RTGVLSDESMKFQLPLGFVLKKDEQPLPMSFDARQKWSYCPSMNMVRNQGCCDSSYAVAAVS 166

  Fly   426 NIEGLYAVKT-GELK-EFSEQELLD-CDTTDSACNGGL--------MDNAYKAIKDIGGLEYEAE 479
            .:...:.|.: |:.: .|...::|. |......|:||:        ::|...:....|..|....
Mosquito   167 TMTDRWCVHSEGKAQFNFGAYDVLSCCHRCGFGCDGGVPSAVWHYWVENGITSGGAFGSHEGCQS 231

  Fly   480 YPYKAKKN--------------QCHFNRTLSHVQVAGFV--DLPKGNETAMQEWLLANGP--ISI 526
            ||:...|.              |..:|.|....:..|.|  .:||..|..|.| :...||  .:.
Mosquito   232 YPFDVCKKSGDSNDTPRCLRFCQPGYNVTYPEDKHYGRVAYTVPKDEERIMYE-VFNFGPAQATF 295

  Fly   527 GINANAMQFYRGGVSHPWKALCSKKNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQG 591
            .:..:.:|:..|...|.:.....    .|.|.|:|:||.:      .:.||:..||||.:||:.|
Mosquito   296 TMYTDFVQYKSGVYRHTFGVRVG----THSVKVMGWGVEN------DVKYWLCANSWGAQWGDGG 350

  Fly   592 YYRVYRGDN 600
            ::::.||::
Mosquito   351 FFKIVRGED 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 12/64 (19%)
Peptidase_C1A 395..611 CDD:239068 59/239 (25%)
AgaP_AGAP004531XP_313831.5 Propeptide_C1 81..>97 CDD:285358 5/16 (31%)
Peptidase_C1A_CathepsinB 132..370 CDD:239111 59/239 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.