DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and AgaP_AGAP007684

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:XP_001687862.1 Gene:AgaP_AGAP007684 / 1269545 VectorBaseID:AGAP007684 Length:463 Species:Anopheles gambiae


Alignment Length:296 Identity:84/296 - (28%)
Similarity:124/296 - (41%) Gaps:57/296 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 TEFADMTSSEYKE----RTGLWQ-RDEAKA-----TGGSAAVVPAYHGELPKEFD----WRQKDA 405
            |.:::....:|.|    |.|.:| |...||     ..|         |.||..||    |  ...
Mosquito   147 TNYSEWWGHKYDEGKVLRLGTFQPRFRVKAMKRLSNKG---------GHLPTRFDASEHW--TGL 200

  Fly   406 VTQVKNQGSCGSCWAFSVTGNIEGLYAV--KTGELKEFSEQELLDCDTTDSACNGGLMDNAYKAI 468
            |.:.::||.|||.||||........:|:  |..|:.:.:.|::|.|......|:||.:|.|::.:
Mosquito   201 VAEARDQGWCGSSWAFSTATMASDRFAILSKGREMVQLAPQQMLACVRRQQGCSGGHLDTAWQYL 265

  Fly   469 KDIGGLEYEAEYPYKAKKNQCHF-----------------NRTLSHVQVAGFVDLPKGNETAMQE 516
            :..|.:..|. |||.|.:|.|..                 ||||.:.....|   ...|||.:..
Mosquito   266 RRTGVVNEEC-YPYIAAQNVCKISNDDTLITANCELPVKVNRTLMYKMGPAF---SLNNETDIMA 326

  Fly   517 WLLANGPISIGINANAMQF-YRGGV-SHPWKAL-CSKKNLDHGVLVVGYGVSDYPNFHKTLPYWI 578
            .:...|.:...:......| ||.|: .|...|. ..:::..|.|.::|:|.....  :..:.|||
Mosquito   327 EIKDRGTVQAIMRVYRDFFSYRSGIYRHSAAATPAEERSAYHSVRLIGWGEERVG--YDVVKYWI 389

  Fly   579 VKNSWGPRWGEQGYYRVYRGDNTCGVSEMATSAVLA 614
            ..||||..|||.|.:|:.||.|.|.:.    |.|||
Mosquito   390 AINSWGQWWGENGRFRILRGSNECDIE----SYVLA 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 1/9 (11%)
Peptidase_C1A 395..611 CDD:239068 68/241 (28%)
AgaP_AGAP007684XP_001687862.1 Somatomedin_B 37..78 CDD:279385
VWC 89..>136 CDD:302663
Peptidase_C1A_CathepsinB 188..421 CDD:239111 70/244 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.