DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and LOC105947118

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:XP_017948891.2 Gene:LOC105947118 / 105947118 -ID:- Length:328 Species:Xenopus tropicalis


Alignment Length:318 Identity:113/318 - (35%)
Similarity:161/318 - (50%) Gaps:40/318 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 FYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNANEMGSAKYGITEFADMTSSE-------- 364
            |..|..:|.:.|.|..|...|..||::||:..:.|...|.|:|:||||:|:|:|..|        
 Frog    27 FENFIAQFNKTYASKEEFHRRFAIFQKNLEEAKRLQREERGTAQYGITKFSDLTDEEFLRCRPDH 91

  Fly   365 ---YKERTGLWQRDEAKATGGSAAVVPAYHGELPKEFDWRQKDAVTQVKNQG-SCGSCWAFSVTG 425
               ::.:|.|.|..|..|        |.      |..|||:|..::..|||| ||.||:||:..|
 Frog    92 RAYFESQTLLRQVTEENA--------PV------KTCDWRKKGVISVPKNQGPSCLSCYAFAAVG 142

  Fly   426 NIEGLYAVKTGELKEFSEQELLDCDTTDSACNGGLMDNAYKAIKDIGGLEYEAEYPYKAKKNQCH 490
            |||..:.: .|..|..|.|:|:||  :...|.||...||:..:..||||..|..|.|..||:.|.
 Frog   143 NIEAQWGI-WGSPKNLSVQQLVDC--SKCGCQGGYTWNAFMTVIKIGGLTNEKNYKYTGKKSTCK 204

  Fly   491 FNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINANAMQFYRGGVSHPWKALCSKKNLDH 555
            .| ......:..||.|.: |||.:...:...|.:::.||...::.|:.||..|....|. .|:||
 Frog   205 TN-LKPEATIQDFVILQR-NETVICSHVSYKGTVTVAINQTLLKQYQKGVIDPHPEKCD-NNVDH 266

  Fly   556 GVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRGDNTCGVSEMATSAVL 613
            .||:||        |.:...|||:|||||..|||.|::|:..|.|.||::|...||::
 Frog   267 AVLIVG--------FSREKKYWILKNSWGNDWGENGFFRLRLGSNACGIAEYPASAIV 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 23/67 (34%)
Peptidase_C1A 395..611 CDD:239068 82/216 (38%)
LOC105947118XP_017948891.2 Inhibitor_I29 27..83 CDD:214853 22/55 (40%)
Peptidase_C1A 115..314 CDD:239068 81/212 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I10947
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.