DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and XB986811

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:XP_017952034.1 Gene:XB986811 / 100490139 XenbaseID:XB-GENE-986812 Length:331 Species:Xenopus tropicalis


Alignment Length:359 Identity:121/359 - (33%)
Similarity:175/359 - (48%) Gaps:60/359 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 PVVQA----RHTRSVEWAEKKTHKKHSHRFDKVDHLFYKFQVRFGRRYVSTAERQMRLRIFR-QN 335
            |:|:|    ..|...||...|| ..|.|..:|:..|.        ||.:    .:..|.|.| .|
 Frog    12 PLVRADLYYNGTLDSEWEIWKT-TYHKHYDNKIHELM--------RRLI----WEKNLNIIRSHN 63

  Fly   336 LKTIEELNANEMGSAKYGITEFADMTSSE-------YKERTGLW------QRDEAKATGGSAAVV 387
            |:..:.|:..|:|..|:|     ||||.|       .|..||:.      ..|||..        
 Frog    64 LEFTQGLHTYELGMNKFG-----DMTSEEVVRMMTGLKVHTGMGPTNLTSDEDEASQ-------- 115

  Fly   388 PAYHGELPKEFDWRQKDAVTQVKNQGSCGSCWAFSVTGNIEGLYAVKTGELKEFSEQELLDCDTT 452
                 .:|...|:|:|..||.:::||.||||||||..|.:||....|||:|...|.|.|:||...
 Frog   116 -----RIPNSIDYRKKGYVTPIRDQGECGSCWAFSTVGALEGQLMKKTGKLVGISPQNLVDCVKD 175

  Fly   453 DSACNGGLMDNAYKAIKDIGGLEYEAEYPYKAKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEW 517
            :..|.||.|..|:|.:|...|::.|..|||.....:|.:|.:....::.||.::.||:|||:::.
 Frog   176 NFGCGGGYMTTAFKYVKKNKGIDSEEAYPYVGMDQKCKYNVSGRAAEIKGFKEVKKGSETALKKA 240

  Fly   518 LLANGPISIGINANAMQF--YRGGVSHPWKALCSKKNLDHGVLVVGYGVSDYPNFHKTLPYWIVK 580
            :...||||:||:|....|  |:.|:.  :...|...:::|.||.||||.      .|...|||:|
 Frog   241 VGLVGPISVGIDAGLDTFFLYKKGIY--YDKSCDGDSINHAVLAVGYGK------QKKGKYWIIK 297

  Fly   581 NSWGPRWGEQGYYRVYR-GDNTCGVSEMATSAVL 613
            ||||..||.:||..:.| ..|.||::.:|:..|:
 Frog   298 NSWGEDWGNKGYILMAREKGNACGIANLASYPVM 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 17/64 (27%)
Peptidase_C1A 395..611 CDD:239068 85/218 (39%)
XB986811XP_017952034.1 Inhibitor_I29 28..87 CDD:214853 23/76 (30%)
Peptidase_C1 117..329 CDD:365882 85/219 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.