DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and LOC100364523

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_001316813.1 Gene:LOC100364523 / 100364523 RGDID:2320837 Length:343 Species:Rattus norvegicus


Alignment Length:333 Identity:119/333 - (35%)
Similarity:181/333 - (54%) Gaps:40/333 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 FD-KVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELN-ANEMGSAKY--GITEFADMT 361
            || .:|..:.::::::.:.| |..|..::..::.:|:|.||..| .|.:|...|  .|.:|||:|
  Rat    21 FDLSLDVQWQEWKMKYEKLY-SPEEELLKRVVWEENVKKIELHNRENSLGKNTYIMEINDFADLT 84

  Fly   362 SSEYKER-TG-----------LWQRDEAKATGGSAAVVPAYHGELPKEFDWRQKDAVTQVKNQGS 414
            ..|:|:. ||           ||:|    |.|.|......:...|||..|||::..||.|:.||.
  Rat    85 DEEFKDMITGITLPINNTMKSLWKR----ALGSSLPNSWYWRDALPKFVDWRKEGYVTHVRVQGR 145

  Fly   415 CGSCWAFSVTGNIEGLYAVKTGELKEFSEQELLDCDTT--DSACNGGLMDNAYKAIKDIGGLEYE 477
            |.|||||.|.|.|||....|||:|...|.|.|:||...  :..|.||...||::.:...||||.|
  Rat   146 CNSCWAFPVVGAIEGQMFKKTGKLTPLSVQNLVDCSKPQGNKGCRGGTTYNAFQYVLQNGGLESE 210

  Fly   478 AEYPYKAKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINA--NAMQFYRGGV 540
            |.|||:.|:..|.:|...|..::..||.||: ||..:.:.:...||::.||:.  ::::||:.|:
  Rat   211 ATYPYEGKEGLCRYNPNNSSAKITRFVALPE-NEDVLMDAVATKGPVAAGIHVVHSSLRFYKKGI 274

  Fly   541 SHPWKALCSKKNLDHGVLVVGYGV----SDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRG-DN 600
            .|..|  |: ..::|.|||||||.    :|..|      ||:::||||.|||..||.::.:. :|
  Rat   275 YHEPK--CN-NYVNHAVLVVGYGFEGNETDGNN------YWLIQNSWGERWGLNGYMKIAKDRNN 330

  Fly   601 TCGVSEMA 608
            .||::..|
  Rat   331 HCGIATFA 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 16/59 (27%)
Peptidase_C1A 395..611 CDD:239068 89/223 (40%)
LOC100364523NP_001316813.1 Inhibitor_I29 29..87 CDD:214853 16/58 (28%)
Peptidase_C1A 126..341 CDD:239068 89/223 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.