DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rtp and RSPH1

DIOPT Version :10

Sequence 1:NP_649520.1 Gene:rtp / 40627 FlyBaseID:FBgn0087005 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_543136.1 Gene:RSPH1 / 89765 HGNCID:12371 Length:309 Species:Homo sapiens


Alignment Length:98 Identity:34/98 - (34%)
Similarity:47/98 - (47%) Gaps:12/98 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 DASRYIGEWNQRGQKHGIGHLQFADGTRYDGQFQEGLSQGVGCLWFADGAKYEGEFHQGWFHGNG 124
            |...|.|..|:.|::||.|..:..:|..|:|.::.|...|.|...|.:||:|.||:.:...||.|
Human    16 DIGEYEGGRNEAGERHGRGRARLPNGDTYEGSYEFGKRHGQGIYKFKNGARYIGEYVRNKKHGQG 80

  Fly   125 IFWRADGMKYEGEFRGGKIWGLGLLTFQDFTHG 157
            .|...||.:||||      |.      .|..||
Human    81 TFIYPDGSRYEGE------WA------NDLRHG 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rtpNP_649520.1 COG4642 <53..153 CDD:443680 31/92 (34%)
RSPH1NP_543136.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42 8/25 (32%)
COG4642 <15..176 CDD:443680 34/98 (35%)
MORN 1 20..43 8/22 (36%)
MORN 2 44..66 7/21 (33%)
MORN 3 67..89 9/21 (43%)
MORN 4 90..112 8/24 (33%)
MORN 5 113..135
MORN 6 159..181
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 222..309
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.