DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment rtp and RSPH1

DIOPT Version :9

Sequence 1:	NP_649520.1	Gene:	rtp / 40627	FlyBaseID:	FBgn0087005	Length:	198	Species:	Drosophila melanogaster
Sequence 2:	NP_543136.1	Gene:	RSPH1 / 89765	HGNCID:	12371	Length:	309	Species:	Homo sapiens

Alignment Length:	98	Identity:	34/98 - (34%)
Similarity:	47/98 - (47%)	Gaps:	12/98 - (12%)

- Green bases have known domain annotations that are detailed below.

  Fly    60 DASRYIGEWNQRGQKHGIGHLQFADGTRYDGQFQEGLSQGVGCLWFADGAKYEGEFHQGWFHGNG 124
            |...|.|..|:.|::||.|..:..:|..|:|.::.|...|.|...|.:||:|.||:.:...||.|
Human    16 DIGEYEGGRNEAGERHGRGRARLPNGDTYEGSYEFGKRHGQGIYKFKNGARYIGEYVRNKKHGQG 80

  Fly   125 IFWRADGMKYEGEFRGGKIWGLGLLTFQDFTHG 157
            .|...||.:||||      |.      .|..||
Human    81 TFIYPDGSRYEGE------WA------NDLRHG 101

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
rtp	NP_649520.1	COG4642	54..>151	CDD:332236	31/90 (34%)
RSPH1	NP_543136.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..42		8/25 (32%)
		COG4642	20..>148	CDD:332236	33/94 (35%)
		MORN 1	20..43		8/22 (36%)
		MORN 2	44..66		7/21 (33%)
		MORN 3	67..89		9/21 (43%)
		MORN 4	90..112		8/24 (33%)
		MORN 5	113..135
		MORN 6	159..181
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	222..309
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG4642
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900