DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rtp and JPH4

DIOPT Version :9

Sequence 1:NP_649520.1 Gene:rtp / 40627 FlyBaseID:FBgn0087005 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_001139500.1 Gene:JPH4 / 84502 HGNCID:20156 Length:628 Species:Homo sapiens


Alignment Length:114 Identity:34/114 - (29%)
Similarity:48/114 - (42%) Gaps:19/114 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SVGVTTARIENQHQQHPHQQGQHGHHQQGQGQSQYSAGAVKVGGWRYEDASRYIGEWNQRGQKHG 76
            |:||.|.         |......||.|||:.:   ..|..:...|.|.      ||| ..|.|..
Human    49 SLGVFTG---------PGGHSYQGHWQQGKRE---GLGVERKSRWTYR------GEW-LGGLKGR 94

  Fly    77 IGHLQFADGTRYDGQFQEGLSQGVGCLWFADGAKYEGEFHQGWFHGNGI 125
            .|..:...|.||.|.:::|...|.|...::||..|:|::..|..||.|:
Human    95 SGVWESVSGLRYAGLWKDGFQDGYGTETYSDGGTYQGQWQAGKRHGYGV 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rtpNP_649520.1 COG4642 54..>151 CDD:332236 23/72 (32%)
JPH4NP_001139500.1 PLN03185 5..>143 CDD:215619 33/112 (29%)
MORN 1 50..72 9/33 (27%)
MORN 2 74..95 8/27 (30%)
MORN 3 96..117 6/20 (30%)
MORN 4 118..140 6/21 (29%)
MORN 5 141..163 1/3 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..214
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 231..276
PLN03185 281..>340 CDD:215619
MORN 7 317..339
MORN 8 340..362
PRK07003 <369..>606 CDD:235906
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 415..602
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.