DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rtp and Morn1

DIOPT Version :9

Sequence 1:NP_649520.1 Gene:rtp / 40627 FlyBaseID:FBgn0087005 Length:198 Species:Drosophila melanogaster
Sequence 2:XP_030109754.1 Gene:Morn1 / 76866 MGIID:1924116 Length:608 Species:Mus musculus


Alignment Length:30 Identity:10/30 - (33%)
Similarity:14/30 - (46%) Gaps:0/30 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 EGEFHQGWFHGNGIFWRADGMKYEGEFRGG 141
            :|::|...|.|.|......|:.|.|.|..|
Mouse   310 QGQWHSDVFSGLGSLVHCSGVTYCGMFING 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rtpNP_649520.1 COG4642 54..>151 CDD:332236 10/30 (33%)
Morn1XP_030109754.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.