powered by:
Protein Alignment rtp and Morn1
DIOPT Version :9
Sequence 1: | NP_649520.1 |
Gene: | rtp / 40627 |
FlyBaseID: | FBgn0087005 |
Length: | 198 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_030109754.1 |
Gene: | Morn1 / 76866 |
MGIID: | 1924116 |
Length: | 608 |
Species: | Mus musculus |
Alignment Length: | 30 |
Identity: | 10/30 - (33%) |
Similarity: | 14/30 - (46%) |
Gaps: | 0/30 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 112 EGEFHQGWFHGNGIFWRADGMKYEGEFRGG 141
:|::|...|.|.|......|:.|.|.|..|
Mouse 310 QGQWHSDVFSGLGSLVHCSGVTYCGMFING 339
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
rtp | NP_649520.1 |
COG4642 |
54..>151 |
CDD:332236 |
10/30 (33%) |
Morn1 | XP_030109754.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4642 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.900 |
|
Return to query results.
Submit another query.