DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rtp and Morn5

DIOPT Version :9

Sequence 1:NP_649520.1 Gene:rtp / 40627 FlyBaseID:FBgn0087005 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_083585.1 Gene:Morn5 / 75495 MGIID:1922745 Length:170 Species:Mus musculus


Alignment Length:141 Identity:34/141 - (24%)
Similarity:56/141 - (39%) Gaps:32/141 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 SRYIGEWNQRGQKHGIGHLQFADGTRYDGQFQEGLSQGVGCLWFADGAKYEGEFHQGWFHGNGIF 126
            |:|.||: ..|:..|.........|||.|:.::|:..|.|.|:|..|::::..:.:| ....|.:
Mouse     6 SQYFGEY-INGRMEGSAEYILPTDTRYIGEMKDGMFHGEGTLFFPSGSRFDAIWKKG-LVVKGKY 68

  Fly   127 WRADGMKYEGEF----------------RGGKIWGLGLLTFQDFTHGFPR-----NEGFFQDC-- 168
            ...||::||.:.                .|.|..|:..||..|.....|.     .:||:...  
Mouse    69 TFNDGLQYEDKHWHYCDSYDRRFYTEICYGLKPSGISQLTNMDPPRRIPLGYYDCGDGFYNPTTR 133

  Fly   169 -------RFMR 172
                   ||:|
Mouse   134 VIKDYRNRFLR 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rtpNP_649520.1 COG4642 54..>151 CDD:332236 26/104 (25%)
Morn5NP_083585.1 COG4642 <5..77 CDD:226989 20/72 (28%)
MORN 1 8..30 5/22 (23%)
MORN 31..53 CDD:280628 8/21 (38%)
MORN 2 31..53 8/21 (38%)
MORN 3 54..75 4/21 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.