| Sequence 1: | NP_649520.1 | Gene: | rtp / 40627 | FlyBaseID: | FBgn0087005 | Length: | 198 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001153420.2 | Gene: | Als2 / 74018 | MGIID: | 1921268 | Length: | 1651 | Species: | Mus musculus |
| Alignment Length: | 213 | Identity: | 55/213 - (25%) |
|---|---|---|---|
| Similarity: | 80/213 - (37%) | Gaps: | 55/213 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 35 GHHQQGQ--GQSQYS------------------AGAVKVGGWRYEDASRYIGEWNQRGQKHGIGH 79
Fly 80 LQFAD---GTRYDGQFQEGLSQGVGCLWFADGAKYEGEFHQGWFHGNGIFWRADGMKYEGEFRGG 141
Fly 142 KIW---GLGLLTFQ--DFTHGFPRNE---------GFFQDCRFMRRRRCPEVVQRAQKCALMARS 192
Fly 193 Q-------------CEHP 197 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| rtp | NP_649520.1 | COG4642 | 54..>151 | CDD:332236 | 36/102 (35%) |
| Als2 | NP_001153420.2 | RCC1 1. /evidence=ECO:0000305 | 59..108 | ||
| RCC1_2 | 93..122 | CDD:290274 | |||
| RCC1 2. /evidence=ECO:0000305 | 109..167 | ||||
| RCC1 | 109..165 | CDD:278826 | |||
| RCC1 3. /evidence=ECO:0000305 | 169..218 | ||||
| RCC1 | 170..216 | CDD:278826 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 425..462 | ||||
| RCC1 4. /evidence=ECO:0000305 | 519..570 | ||||
| RCC1 | 521..568 | CDD:278826 | |||
| RCC1 5. /evidence=ECO:0000305 | 572..621 | ||||
| RCC1 | 573..619 | CDD:278826 | |||
| RhoGEF | 689..873 | CDD:295373 | |||
| PH_alsin | 899..1004 | CDD:241423 | |||
| PH | 920..998 | CDD:278594 | |||
| COG4642 | 1043..1182 | CDD:226989 | 24/88 (27%) | ||
| MORN 1 | 1043..1065 | ||||
| MORN | 1043..1063 | CDD:280628 | |||
| MORN 2 | 1066..1088 | ||||
| MORN 3 | 1094..1116 | 7/19 (37%) | |||
| MORN | 1094..1114 | CDD:280628 | 7/17 (41%) | ||
| MORN 4 | 1117..1139 | 2/21 (10%) | |||
| MORN 5 | 1145..1167 | 8/24 (33%) | |||
| COG4642 | 1166..>1266 | CDD:226989 | 31/101 (31%) | ||
| MORN 6 | 1169..1191 | 7/21 (33%) | |||
| MORN 7 | 1192..1214 | 9/21 (43%) | |||
| MORN 8 | 1215..1238 | 10/24 (42%) | |||
| VPS9 | 1548..1647 | CDD:280383 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG4642 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||