DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rtp and Jph2

DIOPT Version :9

Sequence 1:NP_649520.1 Gene:rtp / 40627 FlyBaseID:FBgn0087005 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_001192005.1 Gene:Jph2 / 59091 MGIID:1891496 Length:696 Species:Mus musculus


Alignment Length:124 Identity:34/124 - (27%)
Similarity:51/124 - (41%) Gaps:36/124 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 HGHHQQG-----QGQSQYSA----GAVKVGGWRYEDASRYIGEWNQRGQKHGIG----------- 78
            |||   |     :||.:||.    |....|.:.:...:.:.|.|:| |::||:|           
Mouse    24 HGH---GLCTGPKGQGEYSGSWNFGFEVAGVYTWPSGNTFEGYWSQ-GKRHGLGIETKGRWLYKG 84

  Fly    79 ------------HLQFADGTRYDGQFQEGLSQGVGCLWFADGAKYEGEFHQGWFHGNGI 125
                        ......|.:|:|.:..||..|.|...:|||..|:|:|..|..||.|:
Mouse    85 EWTHGFKGRYGIRQSTNSGAKYEGTWNNGLQDGYGTETYADGGTYQGQFTNGMRHGYGV 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rtpNP_649520.1 COG4642 54..>151 CDD:332236 25/95 (26%)
Jph2NP_001192005.1 Bipartite nuclear localization signal. /evidence=ECO:0000269|PubMed:30409805 345..359
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 439..664
PHA03307 442..>643 CDD:223039
Nuclear localization signal. /evidence=ECO:0000269|PubMed:30409805 488..492
PLN03185 4..>143 CDD:215619 33/122 (27%)
MORN 1. /evidence=ECO:0000255 14..36 5/14 (36%)
MORN 2. /evidence=ECO:0000255 38..59 4/20 (20%)
MORN 3. /evidence=ECO:0000255 60..79 7/19 (37%)
MORN 4. /evidence=ECO:0000255 82..104 0/21 (0%)
PLN03185 103..>328 CDD:215619 17/41 (41%)
MORN 5. /evidence=ECO:0000255 106..128 9/21 (43%)
MORN 6. /evidence=ECO:0000255 129..151 7/15 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 164..192
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..273
MORN 7. /evidence=ECO:0000255 285..307
MORN 8. /evidence=ECO:0000255 308..330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.