Sequence 1: | NP_649520.1 | Gene: | rtp / 40627 | FlyBaseID: | FBgn0087005 | Length: | 198 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_065970.2 | Gene: | ALS2 / 57679 | HGNCID: | 443 | Length: | 1657 | Species: | Homo sapiens |
Alignment Length: | 213 | Identity: | 56/213 - (26%) |
---|---|---|---|
Similarity: | 81/213 - (38%) | Gaps: | 55/213 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 35 GHHQQGQ--GQSQYS------------------AGAVKVGGWRYEDASRYIGEWNQRGQKHGIGH 79
Fly 80 LQFAD---GTRYDGQFQEGLSQGVGCLWFADGAKYEGEFHQGWFHGNGIFWRADGMKYEGEFRGG 141
Fly 142 KIW---GLGLLTFQ--DFTHGFPRNE---------GFFQDCRFMRRRRCPEVVQRAQKCALMARS 192
Fly 193 Q-------------CEHP 197 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rtp | NP_649520.1 | COG4642 | 54..>151 | CDD:332236 | 36/102 (35%) |
ALS2 | NP_065970.2 | RCC1 1. /evidence=ECO:0000305 | 59..108 | ||
RCC1_2 | 93..122 | CDD:290274 | |||
RCC1 2. /evidence=ECO:0000305 | 109..167 | ||||
RCC1 | 109..165 | CDD:278826 | |||
RCC1 3. /evidence=ECO:0000305 | 169..218 | ||||
RCC1 | 170..216 | CDD:278826 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 432..480 | ||||
RCC1 4. /evidence=ECO:0000305 | 525..576 | ||||
RCC1 | 527..574 | CDD:278826 | |||
RCC1 5. /evidence=ECO:0000305 | 578..627 | ||||
RCC1 | 579..625 | CDD:278826 | |||
RhoGEF | 695..879 | CDD:295373 | |||
PH_alsin | 905..1010 | CDD:241423 | |||
PH | 926..1004 | CDD:278594 | |||
COG4642 | 1049..1188 | CDD:226989 | 24/88 (27%) | ||
MORN 1 | 1049..1071 | ||||
MORN | 1049..1069 | CDD:280628 | |||
MORN 2 | 1072..1094 | ||||
MORN 3 | 1100..1122 | 7/19 (37%) | |||
MORN | 1100..1120 | CDD:280628 | 7/17 (41%) | ||
MORN 4 | 1123..1145 | 2/21 (10%) | |||
MORN 5 | 1151..1173 | 8/24 (33%) | |||
MORN 6 | 1175..1197 | 7/21 (33%) | |||
MORN 7 | 1198..1220 | 9/21 (43%) | |||
MORN 8 | 1221..1244 | 10/24 (42%) | |||
VPS9 | 1554..1653 | CDD:280383 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG4642 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |