DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment rtp and JPH3

DIOPT Version :9

Sequence 1:	NP_649520.1	Gene:	rtp / 40627	FlyBaseID:	FBgn0087005	Length:	198	Species:	Drosophila melanogaster
Sequence 2:	NP_065706.2	Gene:	JPH3 / 57338	HGNCID:	14203	Length:	748	Species:	Homo sapiens

Alignment Length:	124	Identity:	41/124 - (33%)
Similarity:	60/124 - (48%)	Gaps:	13/124 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly    34 HGH----HQQGQGQ--SQYSAGAVKVGGWRYEDASRYIGEWNQRGQKHGIGHLQFADGTRYDGQF 92
            |||    ..:|||:  ..:|.|...:|.:.:...:.|.|.|.| |::|||| |:......|.|::
Human    25 HGHGVCTGPKGQGEYTGSWSHGFEVLGVYTWPSGNTYQGTWAQ-GKRHGIG-LESKGKWVYKGEW 87

  Fly    93 QEGLSQGVG---CLWFADGAKYEGEFHQGWFHGNGIFWRADGMKYEGEFRGGKIWGLGL 148
            ..|.....|   |.  .:||||||.:..|...|.|....:||..|:|::.||...|.|:
Human    88 THGFKGRYGVRECA--GNGAKYEGTWSNGLQDGYGTETYSDGGTYQGQWVGGMRQGYGV 144

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
rtp	NP_649520.1	COG4642	54..>151	CDD:332236	33/98 (34%)
JPH3	NP_065706.2	MORN 1	15..37		4/11 (36%)
		MORN 2	39..60		3/20 (15%)
		MORN 3	61..82		10/22 (45%)
		MORN 4	83..105		5/23 (22%)
		MORN	107..129	CDD:280628	8/21 (38%)
		MORN 5	107..129		8/21 (38%)
		MORN 6	130..152		6/15 (40%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	230..259
		MORN 7	288..310
		MORN	311..333	CDD:280628
		MORN 8	311..333
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	416..496
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	526..597
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	624..649
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG4642
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900