DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment rtp and JPH2

DIOPT Version :9

Sequence 1:	NP_649520.1	Gene:	rtp / 40627	FlyBaseID:	FBgn0087005	Length:	198	Species:	Drosophila melanogaster
Sequence 2:	NP_065166.2	Gene:	JPH2 / 57158	HGNCID:	14202	Length:	696	Species:	Homo sapiens

Alignment Length:	124	Identity:	34/124 - (27%)
Similarity:	52/124 - (41%)	Gaps:	36/124 - (29%)

- Green bases have known domain annotations that are detailed below.

  Fly    34 HGHHQQG-----QGQSQYSA----GAVKVGGWRYEDASRYIGEWNQRGQKHGIG----------- 78
            |||   |     :||.:||.    |....|.:.:...:.:.|.|:| |::||:|
Human    24 HGH---GLCTGPKGQGEYSGSWNFGFEVAGVYTWPSGNTFEGYWSQ-GKRHGLGIETKGRWLYKG 84

  Fly    79 ------------HLQFADGTRYDGQFQEGLSQGVGCLWFADGAKYEGEFHQGWFHGNGI 125
                        ....:.|.:|:|.:..||..|.|...:|||..|:|:|..|..||.|:
Human    85 EWTHGFKGRYGIRQSSSSGAKYEGTWNNGLQDGYGTETYADGGTYQGQFTNGMRHGYGV 143

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
rtp	NP_649520.1	COG4642	54..>151	CDD:332236	25/95 (26%)
JPH2	NP_065166.2	MORN 1. /evidence=ECO:0000255	14..36		5/14 (36%)
		MORN 2. /evidence=ECO:0000255	38..59		4/20 (20%)
		MORN 3. /evidence=ECO:0000255	60..79		7/19 (37%)
		MORN 4. /evidence=ECO:0000255	82..104		0/21 (0%)
		MORN	106..128	CDD:280628	9/21 (43%)
		MORN 5. /evidence=ECO:0000255	106..128		9/21 (43%)
		MORN 6. /evidence=ECO:0000255	129..151		7/15 (47%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	164..193
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	250..282
		MORN 7. /evidence=ECO:0000255	291..313
		MORN	314..336	CDD:280628
		MORN 8. /evidence=ECO:0000255	314..336
		Bipartite nuclear localization signal. /evidence=ECO:0000250\|UniProtKB:Q9ET78	351..365
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	448..652
		Nuclear localization signal. /evidence=ECO:0000250\|UniProtKB:Q9ET78	495..499
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG4642
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900