DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rtp and JPH1

DIOPT Version :9

Sequence 1:NP_649520.1 Gene:rtp / 40627 FlyBaseID:FBgn0087005 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_001304759.1 Gene:JPH1 / 56704 HGNCID:14201 Length:661 Species:Homo sapiens


Alignment Length:387 Identity:66/387 - (17%)
Similarity:105/387 - (27%) Gaps:214/387 - (55%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DYDDDMSSVGVTTARIENQHQQHPHQQGQ-HGH----HQQGQGQ--SQYSAGAVKVGGWRYEDAS 62
            |:||..:..|             ..::|: |||    ..:|||:  ..:|.|...|||:.:...:
Human     7 DFDDGGTYCG-------------GWEEGKAHGHGICTGPKGQGEYSGSWSHGFEVVGGYTWPSGN 58

  Fly    63 RYIGEWNQRGQKHGIG---------HLQFADG--------------TRYDGQFQEGLSQGVGCLW 104
            .|.|.|.| |::||:|         ..:::.|              .||:|.:..||..|.|...
Human    59 TYQGYWAQ-GKRHGLGVETKGKWMYRGEWSHGFKGRYGVRQSLCTPARYEGTWSNGLQDGYGVET 122

  Fly   105 FADGAKYEGEFHQGWFHG----------------------------------------------- 122
            :.||..|:|::..|..||                                               
Human   123 YGDGGTYQGQWAGGMRHGYGVRQSVPYGMATVIRSPLRTSLASLRSEQSNGSVLHDAAAAADSPA 187

  Fly   123 ---------------------NGIF---------------------------------------- 126
                                 .|:|                                        
Human   188 GTRGGFVLNFHADAELAGKKKGGLFRRGSLLGSMKLRKSESKSSISSKRSSVRSDAAMSRISSSD 252

  Fly   127 --------------------------------W------------RADGMKYEGEFRGGKIWGLG 147
                                            |            |::|||||||:...|..|.|
Human   253 ANSTISFGDVDCDFCPVEDHVDATTTETYMGEWKNDKRNGFGVSERSNGMKYEGEWANNKRHGYG 317

  Fly   148 LLTFQDFTHGFPRNEGFFQDCRFMR--------------RRRCPEVVQRAQKCALMARSQCE 195
            ...|.|.:    :.||.:::...:|              |.:....::.||:.|.|||::.|
Human   318 CTVFPDGS----KEEGKYKNNILVRGIRKQLIPIRHTKTREKVDRAIEGAQRAAAMARTKVE 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rtpNP_649520.1 COG4642 54..>151 CDD:332236 39/271 (14%)
JPH1NP_001304759.1 PLN03185 4..>143 CDD:215619 39/149 (26%)
MORN 1 14..36 6/34 (18%)
MORN 2 38..59 5/20 (25%)
MORN 3 60..82 8/22 (36%)
PLN03185 106..>325 CDD:215619 29/218 (13%)
MORN 4 106..128 8/21 (38%)
MORN 5 129..151 5/21 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 228..247 0/18 (0%)
MORN 6 281..303 3/21 (14%)
MORN 7 304..326 9/25 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 433..631
TonB <434..>528 CDD:223880
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.