DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rtp and als2a

DIOPT Version :9

Sequence 1:NP_649520.1 Gene:rtp / 40627 FlyBaseID:FBgn0087005 Length:198 Species:Drosophila melanogaster
Sequence 2:XP_021334529.1 Gene:als2a / 557014 ZFINID:ZDB-GENE-070402-2 Length:1662 Species:Danio rerio


Alignment Length:98 Identity:40/98 - (40%)
Similarity:52/98 - (53%) Gaps:7/98 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 RYEDASRYIGEWNQRGQKHGIGHLQFADGTRYDGQFQEGLSQGVG-----CLWFADGAKYEGEFH 116
            |.:|| :|.|.| ..|:.||.|:|::.|||.|.|.|:.||..|.|     ...|....:|:|.:.
Zfish  1052 RLKDA-KYEGRW-LSGKPHGKGNLKWPDGTMYCGTFKSGLEDGFGDFMTPSTTFNKFERYQGHWK 1114

  Fly   117 QGWFHGNGIFWRADGMKYEGEFRGGKIWGLGLL 149
            :|..||.|.||.|.|..|||.||.....|.|:|
Zfish  1115 EGKMHGFGTFWYASGEVYEGSFRENMRHGHGML 1147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rtpNP_649520.1 COG4642 54..>151 CDD:332236 40/98 (41%)
als2aXP_021334529.1 RCC1 <33..215 CDD:332518
RCC1 529..576 CDD:306840
RCC1_2 563..592 CDD:316098
RCC1 581..627 CDD:306840
PH_alsin 907..1018 CDD:241423
COG4642 1058..>1222 CDD:332236 37/91 (41%)
COG4642 1182..>1275 CDD:332236
VPS9 1559..1657 CDD:308039
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.