DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rtp and jph2

DIOPT Version :9

Sequence 1:NP_649520.1 Gene:rtp / 40627 FlyBaseID:FBgn0087005 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_001082833.1 Gene:jph2 / 553333 ZFINID:ZDB-GENE-030131-9848 Length:781 Species:Danio rerio


Alignment Length:129 Identity:41/129 - (31%)
Similarity:63/129 - (48%) Gaps:23/129 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 HGH----HQQGQGQ--SQYSAGAVKVGGWRYEDASRYIGEWNQRGQKHGIGHLQFADGTRYDGQF 92
            |||    ..:|||:  ..::.|...||.:.:...:.|.|.|:| |::||:| ::......|.|::
Zfish    24 HGHGICTGPKGQGEFSGSWNYGFEVVGVYTWPSGNTYEGYWSQ-GKRHGLG-VETKGHWIYKGEW 86

  Fly    93 QEG--------LSQGVGCLWFADGAKYEGEFHQGWFHGNGIFWRADGMKYEGEFRGGKIWGLGL 148
            ..|        :|||       .||||||.::.|...|.|....|||..::|:|.||...|.|:
Zfish    87 THGFKGRYGTRISQG-------SGAKYEGTWNNGLQDGYGTETYADGGTFQGQFTGGMRHGYGV 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rtpNP_649520.1 COG4642 54..>151 CDD:332236 33/103 (32%)
jph2NP_001082833.1 MORN 106..128 CDD:280628 9/21 (43%)
MORN 324..346 CDD:280628
TonB_N 605..757 CDD:292650
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.