DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rtp and morn4

DIOPT Version :9

Sequence 1:NP_649520.1 Gene:rtp / 40627 FlyBaseID:FBgn0087005 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_001017559.1 Gene:morn4 / 550131 ZFINID:ZDB-GENE-050417-7 Length:146 Species:Danio rerio


Alignment Length:138 Identity:74/138 - (53%)
Similarity:94/138 - (68%) Gaps:1/138 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 GGWRYEDASRYIGEWNQRGQKHGIGHLQFADGTRYDGQFQEGLSQGVGCLWFADGAKYEGEFHQG 118
            |.:.|.....|.|||.: |::||.|.|:|||||.|.|.|:.||..|.|.|.|.||::|||||.||
Zfish     6 GSFTYSSGEEYTGEWKE-GRRHGKGELKFADGTCYKGHFENGLFHGSGVLVFPDGSRYEGEFAQG 69

  Fly   119 WFHGNGIFWRADGMKYEGEFRGGKIWGLGLLTFQDFTHGFPRNEGFFQDCRFMRRRRCPEVVQRA 183
            .|.|.|||.|.||||:||||:.|::.|.|||||.|.:||.|||||.|::.:.::|.:|..|||||
Zfish    70 KFQGVGIFSRFDGMKFEGEFKSGRVEGHGLLTFPDGSHGAPRNEGMFENNKLLKREKCQAVVQRA 134

  Fly   184 QKCALMAR 191
            :..|..||
Zfish   135 KNSASTAR 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rtpNP_649520.1 COG4642 54..>151 CDD:332236 53/96 (55%)
morn4NP_001017559.1 COG4642 6..123 CDD:226989 64/117 (55%)
MORN 16..37 CDD:280628 12/21 (57%)
MORN 39..61 CDD:280628 11/21 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 43 1.000 Domainoid score I12402
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H16635
Inparanoid 1 1.050 155 1.000 Inparanoid score I4271
OMA 1 1.010 - - QHG52381
OrthoDB 1 1.010 - - D1532474at2759
OrthoFinder 1 1.000 - - FOG0008958
OrthoInspector 1 1.000 - - oto39003
orthoMCL 1 0.900 - - OOG6_107888
Panther 1 1.100 - - LDO PTHR46614
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5543
SonicParanoid 1 1.000 - - X1171
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1514.910

Return to query results.
Submit another query.