DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rtp and Rsph1

DIOPT Version :9

Sequence 1:NP_649520.1 Gene:rtp / 40627 FlyBaseID:FBgn0087005 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_609609.1 Gene:Rsph1 / 34712 FlyBaseID:FBgn0032478 Length:344 Species:Drosophila melanogaster


Alignment Length:124 Identity:39/124 - (31%)
Similarity:62/124 - (50%) Gaps:11/124 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GHHQQGQGQSQYSAGAVKVGGWR-YEDASRYIGEWNQRGQKHGIGHLQFADGTRYDGQFQEGLSQ 98
            |.:..||.|.:         ||. ..:..:|.|.: ::|::||||...|.||:||.||::.|...
  Fly    30 GRNAAGQRQGR---------GWAILPNGDQYDGNY-RKGRRHGIGVYVFKDGSRYYGQYRCGKRC 84

  Fly    99 GVGCLWFADGAKYEGEFHQGWFHGNGIFWRADGMKYEGEFRGGKIWGLGLLTFQDFTHG 157
            |.|...:.||:.|||.:.:...||.|.:...:|..|.|::..|:..|:|:..|.....|
  Fly    85 GRGIFIYPDGSVYEGNWRKNLKHGKGRYKYVNGDNYSGDWFKGQRHGVGIYHFNSGKDG 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rtpNP_649520.1 COG4642 54..>151 CDD:332236 33/97 (34%)
Rsph1NP_609609.1 MORN 51..73 CDD:280628 10/22 (45%)
MORN 72..93 CDD:197832 7/20 (35%)
MORN 95..116 CDD:197832 6/20 (30%)
MORN 118..137 CDD:197832 5/18 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.