DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rtp and Jph4

DIOPT Version :10

Sequence 1:NP_649520.1 Gene:rtp / 40627 FlyBaseID:FBgn0087005 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_796023.2 Gene:Jph4 / 319984 MGIID:2443113 Length:628 Species:Mus musculus


Alignment Length:114 Identity:34/114 - (29%)
Similarity:48/114 - (42%) Gaps:19/114 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SVGVTTARIENQHQQHPHQQGQHGHHQQGQGQSQYSAGAVKVGGWRYEDASRYIGEWNQRGQKHG 76
            |:||.|.         |......||.|||:.:   ..|..:...|.|.      ||| ..|.|..
Mouse    49 SLGVFTG---------PGGHSYQGHWQQGKRE---GLGVERKSRWTYR------GEW-LGGLKGR 94

  Fly    77 IGHLQFADGTRYDGQFQEGLSQGVGCLWFADGAKYEGEFHQGWFHGNGI 125
            .|..:...|.||.|.:::|...|.|...::||..|:|::..|..||.|:
Mouse    95 SGVWESVSGLRYAGLWKDGFQDGYGTETYSDGGTYQGQWQAGKRHGYGV 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rtpNP_649520.1 COG4642 <53..153 CDD:443680 23/73 (32%)
Jph4NP_796023.2 COG4642 <4..143 CDD:443680 33/112 (29%)
MORN 1 15..37
MORN 2 39..60 5/19 (26%)
MORN 3 61..82 6/23 (26%)
MORN 4 83..105 8/28 (29%)
MORN 5 106..128 7/21 (33%)
MORN 6 129..151 6/15 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..214
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 231..276
COG4642 <281..>336 CDD:443680
MORN 7 282..304
MORN 8 305..327
PRK07003 <369..>606 CDD:235906
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 418..603
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.