DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rtp and Morn4

DIOPT Version :9

Sequence 1:NP_649520.1 Gene:rtp / 40627 FlyBaseID:FBgn0087005 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_001020146.1 Gene:Morn4 / 293950 RGDID:1307336 Length:146 Species:Rattus norvegicus


Alignment Length:139 Identity:71/139 - (51%)
Similarity:93/139 - (66%) Gaps:1/139 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 GGWRYEDASRYIGEWNQRGQKHGIGHLQFADGTRYDGQFQEGLSQGVGCLWFADGAKYEGEFHQG 118
            |.:.|.....|.|||.: |::||.|.|.||||..|.|.|:.||..|.|.|.|:||::|||||.||
  Rat     6 GSFTYSSGEEYRGEWKE-GRRHGFGQLMFADGGTYLGHFENGLFNGFGVLTFSDGSRYEGEFSQG 69

  Fly   119 WFHGNGIFWRADGMKYEGEFRGGKIWGLGLLTFQDFTHGFPRNEGFFQDCRFMRRRRCPEVVQRA 183
            .|:|.|:|.|.|.|.:||||:.|::.|.|||||.|.:||.|||||.|::.:.:||.:|..|||||
  Rat    70 KFNGVGVFIRYDNMTFEGEFKNGRVDGFGLLTFPDGSHGLPRNEGLFENNKLLRREKCSAVVQRA 134

  Fly   184 QKCALMARS 192
            |..:..||:
  Rat   135 QSASKSARN 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rtpNP_649520.1 COG4642 54..>151 CDD:332236 49/96 (51%)
Morn4NP_001020146.1 COG4642 5..106 CDD:226989 52/100 (52%)
MORN 1 16..38 13/22 (59%)
MORN 2 39..61 11/21 (52%)
MORN 3 62..84 13/21 (62%)
MORN 4 85..107 12/21 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11828
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H16635
Inparanoid 1 1.050 153 1.000 Inparanoid score I4254
OMA 1 1.010 - - QHG52381
OrthoDB 1 1.010 - - D1532474at2759
OrthoFinder 1 1.000 - - FOG0008958
OrthoInspector 1 1.000 - - oto98519
orthoMCL 1 0.900 - - OOG6_107888
Panther 1 1.100 - - LDO PTHR46614
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1171
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.